KEGG   Helicobacter pylori SNT49: HPSNT_04800Help
Entry
HPSNT_04800       CDS       T01916                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hen  Helicobacter pylori SNT49
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hen00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HPSNT_04800 (recR)
DNA repair and recombination proteins [BR:hen03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HPSNT_04800 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
980772..981353
Genome map
AA seq 193 aa AA seqDB search
MNTYKNSLNHFLNLVDCLEKIPNVGKKSAFKMAYHLGLENPYLALKITHALENALENLKT
CASCNALSESEVCEICSDESRQNSQICMVLHPRDVFILEDLKDFLGRYYVLNSIEEVDFN
ALEKRLIEENIKEIIFAFPPTLANDSLMLYIEDKLQHFHLTFTKIAQGVPTGVNFENIDS
VSLSRAFNSRIKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttataaaaacagcttgaatcactttttaaatttagtggattgtttagaaaaa
atccccaatgtgggtaaaaagtccgcctttaaaatggcgtatcatttgggtttagaaaac
ccctatctggcgctcaaaatcacgcacgctttagagaacgccctagaaaatcttaaaaca
tgcgcatcttgtaacgcgctcagtgagagtgaggtttgtgaaatttgctctgatgagagc
cggcaaaattctcagatttgcatggttttacacccaagagatgtgtttattttagaagat
ttaaaggattttttagggcgctattatgtgttaaattctatagaagaagtggattttaac
gccctagaaaaacgcctgattgaagaaaacattaaagaaatcatttttgctttccctccc
actttggctaatgattctttaatgctttatattgaagataaattacagcatttccacctc
actttcactaaaatcgctcaaggcgtgcctactggagtgaattttgaaaacattgactca
gtttcgctctcaagggcgtttaattcaaggatcaaagcatga

DBGET integrated database retrieval system