KEGG   Helicobacter pylori SNT49: HPSNT_05510Help
Entry
HPSNT_05510       CDS       T01916                                 

Gene name
porA
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hen  Helicobacter pylori SNT49
Pathway
hen00010  Glycolysis / Gluconeogenesis
hen00020  Citrate cycle (TCA cycle)
hen00620  Pyruvate metabolism
hen00640  Propanoate metabolism
hen00650  Butanoate metabolism
hen00680  Methane metabolism
hen01100  Metabolic pathways
hen01120  Microbial metabolism in diverse environments
hen01130  Biosynthesis of antibiotics
hen01200  Carbon metabolism
Module
hen_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSNT_05510 (porA)
   00020 Citrate cycle (TCA cycle)
    HPSNT_05510 (porA)
   00620 Pyruvate metabolism
    HPSNT_05510 (porA)
   00640 Propanoate metabolism
    HPSNT_05510 (porA)
   00650 Butanoate metabolism
    HPSNT_05510 (porA)
  Energy metabolism
   00680 Methane metabolism
    HPSNT_05510 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPSNT_05510 (porA)
Enzymes [BR:hen01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPSNT_05510 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AEN17237
UniProt: G2MCD0
Position
1128895..1130118
Genome map
AA seq 407 aa AA seqDB search
MAKSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYIDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFRIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDTVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAVLDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIVHLCGIFEEINEDALKGTLTHPTQQFVGLHGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagtattgaattgcaagagatagaagtgtgggatggcaataccgctagttct
aacgctttaagacaagctcaaattgatgtcatcgcagcctatcctatcaccccatcaacg
cccattgtgcaaaattatggctcgtttaaggacaatggctatattgatggcgaatttgtt
ttagtggaatctgagcatgccgccatgagtgcatgcgtgggagctgcagcagctggaggg
agagtcagcactgcgactagctctcaaggtttggcgttaatggtagaggttttataccag
gcttctgggatgcgtttgcctatcgttttgaatttagtcaatcgtgctttagcagcccct
ttgaatatccatggcgatcattctgatatgtatttgagcagggattctggctggataagt
ttatgcacatgcaacccccaagaggcttatgatttcactttaatggcgtttagaatcgca
gagcatcaaaaggtgcgcgtgcctactattgtcaatcaagacgggtttttatgctcgcac
accgtgcaaaatgtccgccctttgagcgatacagtggcttaccaattcgtgggcgaatac
caaaccaagcattcccttttggattttgataaaccggtaagctatggcgcacaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgcgatcatgagcgcgtcttct
gtgattgaagaagtgtttaatgatttcgctaaactcaccggcagacaataccatttgact
aaaactttccagctagaagacgctgaaatcgctatctttgcgttaggcaccacttatgaa
tcagcgatcgtagcagctaaagaaatgcgtaaaaaaggcattaaggccggcgtggctacc
atccattccttacgccctttcccttatgaaagattagggcaggatttgaaaaatcttaaa
gctttagcggttttagacaagagttctccagcgggtgctatgggagcgatgtttaatgag
gtaacgagtgcggtgtatcaaacgcaagggactaaacaccctgtggtgtctaactacatt
tatggtttaggcgaaagggatatgacaatcgtgcatttatgcggaatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggcttgcac
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system