KEGG   Helicobacter pylori SNT49: HPSNT_06130Help
Entry
HPSNT_06130       CDS       T01916                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hen  Helicobacter pylori SNT49
Pathway
hen00860  Porphyrin and chlorophyll metabolism
hen01100  Metabolic pathways
hen01110  Biosynthesis of secondary metabolites
hen01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPSNT_06130 (hemD)
Enzymes [BR:hen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HPSNT_06130 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Peptidase_S41
Motif
Other DBs
NCBI-ProteinID: AEN17355
UniProt: G2MFG7
Position
1258712..1259392
Genome map
AA seq 226 aa AA seqDB search
MREVVWVHSQRIAPYKTLVLNELCYYPLELDPTPFNALIFTSKNAVFSLLETLKDSPKLK
ILQNIPAYALSEPTAKTLQDHHFKVAFIGKKAHGKEFVQEILPLLEKKSVLYLRAKEIAS
SLDTILLEHGIDFRQVVVYENKLKHLTLSEQNALKPKEKSVLIFTAISHAKAFLHYFEFL
ENYTAISIGNTTALYLQEQGIPSYIAKKPSLEACLELALSLRIKEC
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagggaggttgtatgggtgcattctcaaagaatcgccccttataagactctcgtttta
aatgaattgtgctactatccgctagaattagatccaaccccttttaacgctcttattttc
acttctaaaaatgcggtgttttccttgctagaaaccctaaaagacagccccaaactcaaa
attttacaaaacattcctgcttacgctttgagcgaacccaccgcaaaaactttacaagat
caccattttaaagtcgcctttataggaaaaaaagcccatggcaaagagttcgttcaagaa
atccttcctttattggaaaaaaaaagcgttctgtatctcagggcaaaagagattgcttct
tctttagacaccattcttttagagcatggcattgatttcaggcaagtcgttgtttatgaa
aacaagctcaaacatttaaccttaagcgagcaaaacgccctaaaacccaaagaaaagagc
gttcttatttttaccgccataagccatgcaaaagcctttttacactattttgaattttta
gaaaattacaccgctataagcattggcaacacgaccgctctttatttacaagaacaaggc
attccaagctatattgccaaaaaaccctccttagaagcgtgtttagagttggctttgagt
ttgaggattaaggaatgttaa

DBGET integrated database retrieval system