KEGG   Helicobacter pylori SNT49: HPSNT_06420Help
Entry
HPSNT_06420       CDS       T01916                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hen  Helicobacter pylori SNT49
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hen00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPSNT_06420 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSNT_06420 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSNT_06420 (trpA)
Enzymes [BR:hen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPSNT_06420 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1311050..1311838)
Genome map
AA seq 262 aa AA seqDB search
MRYQNMFEALKKQDKMAFIPFVTLGDPNYEWSFEIIKTLIDSEVSALELGFAFSDPVADG
VTIQASHLRALKHASMAKNFQLLKKIRDYNHDIPIGLLAYANLIFSYGVDNFYAQVKECS
VDSVLIADMPLIEKELVIKSAQKHHIKQIFIASPNASDKDLEQAAMHSQGYIYTLARSGV
TGASRILENDASAIIKTLKAFSPTPALLGFGISKKEHITNAKGMGADGVICGSALVKIIE
ENLNNENAMLEKIESFVREMVG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatcaaaacatgtttgaagccttaaagaaacaagacaaaatggcgtttatcccg
tttgtaaccttgggtgatcctaattatgaatggagttttgaaatcattaaaaccctaatt
gatagcgaggtgagcgctttagaattgggctttgctttctcagaccctgtagcggatggc
gttaccatacaagcgagccatttaagagcgttaaaacacgctagcatggctaaaaatttc
cagcttttaaaaaagattagagactacaaccatgatattcccatagggcttttagcgtat
gcgaatctcattttttcttatggcgtggataatttttacgcccaagtcaaagaatgcagc
gtggatagcgttttaatagcggatatgcccctaatagaaaaagaattagtcatcaaatcc
gctcaaaaacaccacattaaacaaatctttatcgccagccctaatgcgagtgataaagat
ttagaacaagccgctatgcattcgcaaggctatatctacactttagccaggagtggggtt
acaggagcgagccgtattttagaaaatgacgcgagcgctattattaaaaccttaaaagcc
tttagccccaccccagccttactgggctttggcatttctaaaaaagaacacatcacaaac
gctaaaggcatgggcgctgatggcgtgatttgtggctcagcgttagtcaaaatcatagaa
gaaaatttaaacaacgaaaacgccatgctggaaaaaattgagagttttgtaagggagatg
gttggttga

DBGET integrated database retrieval system