KEGG   Helicobacter pylori SNT49: HPSNT_06430Help
Entry
HPSNT_06430       CDS       T01916                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hen  Helicobacter pylori SNT49
Pathway
hen00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hen01100  Metabolic pathways
hen01110  Biosynthesis of secondary metabolites
hen01130  Biosynthesis of antibiotics
hen01230  Biosynthesis of amino acids
Module
hen_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hen00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSNT_06430
Enzymes [BR:hen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPSNT_06430
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HPSNT_06430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AEN17415
UniProt: G2MCF6
Position
complement(1313018..1314376)
Genome map
AA seq 452 aa AA seqDB search
MPSVLENILKDKLLEVSILKKNHALAININPSDRDFKKALLETKTSFILECKKASPSKGL
IRKDFDLLKIAKTYEKFASCISVLADSKHFLGSYENIKIVSQHSAKPVLCKDFIIDAFQI
KLARMMGANAVLLMLSVLDDKNYSELFNLAKSLNMSVLTEVSNQQEIKRLLKLQYDIIGI
NNRDLHTLTTDINNTLKLRPLLPKDALVVSESGIHSHAQIKALTPYVNGFLVGSSLMKEK
DLKKACIKLILGENKVCGLTKIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAV
KKLDFVGVFVKDKIKKIQKIAKKLDLKAVQLYGYSQQEIAQLKKSLPKTCAIWQVVNVMS
ANDLAPKAKEASLILYDTKGDKMGGNGVSFDWGVLENVKTPFMLAGGLNLDNIQKALKIK
ALGLDFNSGLEISPGIKNKDTIKRLARILREY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtgttagaaaacatccttaaagacaagctcctagaagtctctatactcaaa
aaaaatcacgctttagcgataaacataaacccaagcgacagggattttaaaaaagcgtta
ttggaaacaaagaccagctttattttagaatgcaaaaaagcatcgccctctaaaggttta
ataagaaaagattttgatctgttaaaaatagccaagacttatgaaaaattcgcctcttgc
atttcagtcttggcggattctaaacattttttaggctcctatgaaaacattaagattgtt
tcgcaacattccgccaagcctgttttatgcaaagattttatcattgatgcttttcaaatc
aaactcgctagaatgatgggagctaacgcggtgcttttaatgttaagcgtgttagatgat
aaaaattattcagagcttttcaacctcgctaaatccttaaacatgagcgtgctaactgaa
gtttctaaccagcaagaaatcaagcgcttgctcaaactccaatacgacattataggcatc
aataacagggatttgcacaccctgacaaccgacattaataacacgctcaaattacgccct
ctcttgcctaaagacgcgctcgtggtgagtgagtccggtattcattcgcatgcgcaaatc
aaagccctaaccccttatgtgaatggctttttagtgggcagctctttaatgaaagaaaag
gatttgaaaaaagcgtgtattaaattgattttaggcgaaaataaagtgtgcgggcttaca
aaaattaaagacgctaaagccgtttataaaaaccattttatttatgggggtttgattttt
gaaaaatcttcgcccagatacatcaagcctaaagaagccctaaaaatcacaaaagcggtt
aaaaaattggattttgtgggcgtgtttgtgaaagataagattaaaaaaattcaaaaaatc
gctaaaaagcttgatttaaaagcggtgcagctttatggctattcgcaacaagaaatcgct
caattaaaaaaatcgctccctaaaacttgcgcgatttggcaagtagtgaatgtgatgagt
gctaacgatttagcgcctaaagctaaagaagcctctctcatcttatacgacactaagggg
gataaaatgggaggcaatggcgtgagttttgattggggtgttttagaaaatgtcaaaacg
cctttcatgttagctggtgggcttaatttggataatattcaaaaagccttgaaaattaaa
gcgttggggttggatttcaattcgggtttagaaataagccctgggattaaaaataaggat
acaatcaagcgattagcccgaattttaagagagtattaa

DBGET integrated database retrieval system