KEGG   Helicobacter pylori SNT49: HPSNT_07130Help
Entry
HPSNT_07130       CDS       T01916                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hen  Helicobacter pylori SNT49
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hen00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1441615..1442418
Genome map
AA seq 267 aa AA seqDB search
MHVFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDKLKDIISVKSALSFSLKGDFDCPLE
KNSLFKALQILKNFLKSKNFSHSVIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHLN
HIFDWRLSLEELYSMGSLVGADTNFFISQYKSANATSYGEVIENFEEEPLENRLEIYAPN
HVFCSTKAIYQAYKPETCFSQAKEWLKRPSLECLKTCDRNELNDLLKSALLTNQALRGIE
SELGKEWFFSGSGSAFFRLKPTLKGGE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtttttgaagtttatcctaaagtcaatatttttttaaagatccttcacaaagaa
ggggcttaccataagctcatttctcgcatgtgcttagtcaaagataagctaaaggatatt
atcagcgtcaaaagcgcgctttccttttcactaaaaggggattttgattgtcctttagaa
aaaaactcgctctttaaagccctccaaattttaaaaaattttttaaaatcaaaaaatttc
tctcattctgtcatcaaatccctagacaccctagcgattgaagtggaaaaaaacatcccc
actcaagccggattaggcggtgggagcgctgatgctggggggctattgtatcatctgaat
cacatttttgactggcgtttgagtttagaagagctttatagcatgggatctttagtgggt
gcggacaccaattttttcatctcgcaatacaaaagtgctaacgctacttcttatggcgaa
gtcattgaaaattttgaagaagagcctttagaaaaccgcctagaaatctatgcgccaaat
catgttttttgcagcaccaaagccatctatcaagcttataagcctgaaacttgtttttct
caagctaaagaatggcttaaaagaccgagtttagaatgcctaaaaacttgcgacagaaac
gaattaaacgatcttttaaagtcagctttactcactaaccaagccttaagaggtatagaa
agcgaattgggcaaggagtggttttttagcgggagcgggagcgcgttttttaggttaaag
cctacgctaaaagggggcgaatga

DBGET integrated database retrieval system