KEGG   Helicobacter pylori SNT49: HPSNT_07225Help
Entry
HPSNT_07225       CDS       T01916                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hen  Helicobacter pylori SNT49
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1459253..1460305
Genome map
AA seq 350 aa AA seqDB search
MKKSVLWGVCLAFSCAHALNDLELIKKARESQLEPIPMGKALKEYQIKKTRDVGIGTKNS
EIMTPAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLVPSAIGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVVEKINSMPGYVKFFRKAYG
SKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNPKALSKAEKEGLDLFISKGCVACHNG
INLGGTMQPLGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEINDEEAKKIETFFEALKGKKPKILYPELPVITDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccgttttatggggcgtttgcttggctttttcttgcgcccatgccttgaac
gatttagaactgatcaaaaaagcgagggaaagccaattagagcctatacctatgggcaaa
gcgctcaaagaataccagatcaaaaaaaccagagatgtgggtattggcaccaaaaacagc
gagatcatgacccccgctcaagtggaattaggcaaaatgctctattttgaccctaggatt
tccacttcctatctcgtgtcttgcaacacatgccataatctaggcttaggcggggtggat
ttagtcccaagcgctatcggttctcaatggaagaaaaacccccaccttttaagctcccca
acggtgtataactctgtgtttaacgatgtgcagttttgggatggtagggttacgcattta
aacgaacaagcgcaagggccaatccaatcttcttttgaaatgggggctgatccaaaagtg
gtggtagaaaaaatcaattccatgccaggctatgtcaaattctttagaaaagcttacggc
tctaaagtcaaaattgattttaaattgatcgccgatagtatcgctatgtttgaagccacg
ctcatcaccccaagccgttatgatgattttttaagaggcaatcctaaagcgctcagtaaa
gccgaaaaagaagggctggatttattcatttctaaaggctgtgtggcttgccataacggc
attaatcttgggggaacgatgcagcctttgggggtggtcaaaccctataaattcgctaat
gtgggcgatttcaaaggcgataaaaacgggcttgtgaaagtgcctactttaaggaatatc
actgaaacgatgccttatttccataacgggcaattttgggatgtcaaggatgcgattaaa
gaaatgggctctatccagttaggcattgaaatcaacgatgaagaagcgaaaaaaattgaa
accttctttgaagctttaaagggtaaaaaacctaaaatactctatccagaactccctgta
ataacagacaaaacccctaaaccctctttttga

DBGET integrated database retrieval system