KEGG   Helicobacter pylori SNT49: HPSNT_07225Help
Entry
HPSNT_07225       CDS       T01916                                 

Definition
(GenBank) cytochrome c551 peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
hen  Helicobacter pylori SNT49
Brite
Enzymes [BR:hen01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HPSNT_07225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3 FixO
Motif
Other DBs
NCBI-ProteinID: AEN17566
UniProt: G2MFM0
Position
1459253..1460305
Genome map
AA seq 350 aa AA seqDB search
MKKSVLWGVCLAFSCAHALNDLELIKKARESQLEPIPMGKALKEYQIKKTRDVGIGTKNS
EIMTPAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLVPSAIGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVVEKINSMPGYVKFFRKAYG
SKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNPKALSKAEKEGLDLFISKGCVACHNG
INLGGTMQPLGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEINDEEAKKIETFFEALKGKKPKILYPELPVITDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccgttttatggggcgtttgcttggctttttcttgcgcccatgccttgaac
gatttagaactgatcaaaaaagcgagggaaagccaattagagcctatacctatgggcaaa
gcgctcaaagaataccagatcaaaaaaaccagagatgtgggtattggcaccaaaaacagc
gagatcatgacccccgctcaagtggaattaggcaaaatgctctattttgaccctaggatt
tccacttcctatctcgtgtcttgcaacacatgccataatctaggcttaggcggggtggat
ttagtcccaagcgctatcggttctcaatggaagaaaaacccccaccttttaagctcccca
acggtgtataactctgtgtttaacgatgtgcagttttgggatggtagggttacgcattta
aacgaacaagcgcaagggccaatccaatcttcttttgaaatgggggctgatccaaaagtg
gtggtagaaaaaatcaattccatgccaggctatgtcaaattctttagaaaagcttacggc
tctaaagtcaaaattgattttaaattgatcgccgatagtatcgctatgtttgaagccacg
ctcatcaccccaagccgttatgatgattttttaagaggcaatcctaaagcgctcagtaaa
gccgaaaaagaagggctggatttattcatttctaaaggctgtgtggcttgccataacggc
attaatcttgggggaacgatgcagcctttgggggtggtcaaaccctataaattcgctaat
gtgggcgatttcaaaggcgataaaaacgggcttgtgaaagtgcctactttaaggaatatc
actgaaacgatgccttatttccataacgggcaattttgggatgtcaaggatgcgattaaa
gaaatgggctctatccagttaggcattgaaatcaacgatgaagaagcgaaaaaaattgaa
accttctttgaagctttaaagggtaaaaaacctaaaatactctatccagaactccctgta
ataacagacaaaacccctaaaccctctttttga

DBGET integrated database retrieval system