KEGG   Helicobacter pylori SNT49: HPSNT_07635Help
Entry
HPSNT_07635       CDS       T01916                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hen  Helicobacter pylori SNT49
Pathway
hen00220  Arginine biosynthesis
hen00330  Arginine and proline metabolism
hen01100  Metabolic pathways
hen01110  Biosynthesis of secondary metabolites
hen01130  Biosynthesis of antibiotics
hen01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hen00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HPSNT_07635
   00330 Arginine and proline metabolism
    HPSNT_07635
Enzymes [BR:hen01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPSNT_07635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEN17646
UniProt: G2MCM9
Structure
PDB: 

Jmol
Position
complement(1544680..1545648)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRLLREALSTTHGDVIKGMQTITQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMREVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEKSERDVIKELQIPLFSVDAIRENMQEVVQKTKESLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDRLKAVEVTEYNPTVSAKHTNEEEKQVLE
ILDLIINSCKIKDKKHSFARSY
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattagaagcggagttaggagcgtcaaaaagaggcaccgataaaggg
gttaggcttttgagagaggctttgagcaccacgcatggcgatgtgattaaaggcatgcaa
acgatcactcaagagcggtgcgtgctttataaagagttcagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgcgggaagtgtttgaaaaa
aaagaattccctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcacacggcttatgacagcgattcaaaacatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagcgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctctgctcgttggggctagaaaagggagggttggaaatcgatcctaaatgtttggtg
tattttggggtaagaagcacagaaaaaagcgaaagagatgtgattaaggaattgcaaatc
cctttatttagcgtggatgcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaatcattaaaagcggtggatattatttatctcagtttggatttagacattatggacggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgaattaaag
caattactgggcttgcttttagaaagttttaaagacagattaaaagcggttgaggtaacc
gaatacaaccccacggtgagcgccaaacacaccaacgaagaagaaaagcaggttttagag
atcttagatctcatcatcaatagctgtaaaattaaagataagaagcactcttttgcaagg
agttactga

DBGET integrated database retrieval system