KEGG   Helicobacter pylori 26695: C694_01065Help
Entry
C694_01065        CDS       T02282                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
heo  Helicobacter pylori 26695
Pathway
heo00300  Lysine biosynthesis
heo01100  Metabolic pathways
heo01120  Microbial metabolism in diverse environments
heo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:heo00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    C694_01065
Enzymes [BR:heo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     C694_01065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AFV41434
UniProt: O25002
Position
complement(219101..220252)
Genome map
AA seq 383 aa AA seqDB search
MDALEITQKLISYPTITPKECGIFEYIKSLFPHFKTLECGENGVKNLFLYRIFNPPKDHA
EEKHAKENTKPLHFCFAGHIDVVPPGNHWQSDPFKPVIKEGFLYGRGAQDMKGGVGAFLS
ASLNFNPKTPFLLSILLTSDEEGPGIFGTRLMLEKLKEKDLLPHMAIVAEPTCEKVLGDS
IKIGRRGSINGKLILKGVQGHVAYPQKCQNPIDTLASVLPLISGVNLDNGDEYFDPSKLV
ITNLHAGLGANNITPASVEIIFNARHSLKTTKESLKEYLEKVLKDLPYTLELESSSSPFI
TASHSKLTSVLKENILKTCHTTPLLNTKGGTSDARFFSAHGIEVVEFGVINDRIHAIDER
VSLKELELLEKVFLGVLEGLSEA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggacgctttagaaatcacccaaaagctcatcagctaccccaccattacgcccaaagaa
tgcggtatttttgaatacattaaatcgctttttcctcattttaaaactctagagtgtgga
gaaaatggcgtgaaaaacctttttttataccgcatttttaacccccccaaagaccatgca
gaagaaaagcatgcaaaagagaataccaagcccttgcatttttgctttgcagggcatatt
gatgtcgtgcctcctggaaatcattggcaaagcgatccttttaaacccgttattaaagag
gggtttttatacggccgtggggcgcaagacatgaaaggaggcgtgggggcgtttttgagc
gcgagtttaaattttaaccctaaaaccccttttttgctttctattttactcacaagcgat
gaagaagggccagggatttttggcactaggcttatgttagaaaaactcaaagaaaaagat
ttgctgcctcatatggcgattgtggctgaacccacttgcgaaaaagtcttaggcgatagc
atcaaaattggccgaagaggctccattaatggcaaactcattttaaaaggcgttcaaggg
catgtggcttacccgcaaaaatgccaaaaccctattgatacgctcgcttcggttttgcct
ctcatttcaggagttaatttagacaatggcgatgaatattttgacccttcaaaattagtc
atcaccaacttgcatgcagggttaggagcgaataatattaccccagcaagcgtagaaatc
atctttaatgcacgccattctttaaaaaccaccaaagagagtttgaaagaatatttagaa
aaagttttgaaagatttgccttatactttagaattagaatcaagcagttcgcctttcatc
acggcttctcattcaaagcttaccagcgttttaaaagaaaatattttaaaaacatgccac
accaccccccttttaaacaccaaaggcggcacgagcgatgcgcgattttttagcgctcat
ggtatagaagtggtggagtttggcgttattaatgacaggatccatgccattgatgaaagg
gtgagcttgaaagaattagagcttttagaaaaagtgtttttgggggttttagagggcttg
agtgaggcataa

DBGET integrated database retrieval system