KEGG   Helicobacter pylori 26695: C694_01090Help
Entry
C694_01090        CDS       T02282                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
heo  Helicobacter pylori 26695
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:heo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C694_01090
Enzymes [BR:heo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     C694_01090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
224695..225801
Genome map
AA seq 368 aa AA seqDB search
MVVLGSTGSIGKNALKIAKKFGIEIEALSCGKNIALINEQIQVFKPKKVAILDPSDLNDL
EPLGAEVFVGLEGIDAMIEECTSNLVLNAIVGVAGLKASFKSLQRNKKLALANKESLVSA
GHLLDISQITPIDSEHFGLWALLQNKTLKPKSLIISASGGAFRDTPLEFIPIQNAQNALK
HPNWSMGSKITIDSASMVNKLFEILETYWLFGASLKIDALIERSSIVHALVEFEDNSIIA
HLASADMQLPISYAIDPKLASLSASIKPLDLYALSAIKFEPISMERYTLWCYKDLLLENP
KLGVVLNASNEVAMEKFLNKEIAFGGLIQTISQALESYDKMPFKLSSLEEVLELDKEVRE
RFKNVAGV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggttgttttaggaagcaccggctctattgggaaaaacgccctaaaaatcgcaaaaaaa
tttggcatagaaatagaggccttaagctgtgggaaaaatatcgctttaatcaatgaacaa
atccaagttttcaaacccaagaaagtggcgattttagatcctagcgatttgaatgattta
gagcctttgggtgcggaagtgtttgtggggttagagggcattgatgcgatgatagaagag
tgcacctcaaatttagtccttaacgccattgtgggcgtggcaggattgaaagcgagcttt
aaaagcttacaaaggaataaaaaactggccctagcgaataaagaaagcttagtgagcgcg
gggcatttattagacatttcacaaatcacgcccattgatagcgagcattttggtttgtgg
gcgttgttgcaaaacaagactttaaagcctaaatccttaatcattagcgcgagtgggggg
gctttcagggacacgcctttagaatttattcctattcaaaacgcgcaaaatgcgctcaag
caccctaattggagcatgggatctaaaatcaccattgattcagcgagcatggtcaataag
ctttttgaaatcctagaaacttattggctttttggcgcgtctttaaagattgatgcgctg
attgaaaggagttctatcgtgcatgctttggtggagtttgaagacaactctatcatcgcg
catttagcgagcgcagatatgcaattacccataagctatgcgatcgatccgaagttggcc
tctttgagcgcgtctatcaagcccttagatctatacgctttaagcgcgattaaatttgaa
cccattagcatggagcgctacactttgtggtgttataaagacttactgctagaaaaccct
aagcttggcgtggtgctgaatgcgagcaatgaagtggcgatggagaagtttttaaacaaa
gagatcgcttttggtggccttatccaaaccatttctcaagccttagaatcatacgataaa
atgcctttcaagctctctagtttagaagaagtgctggaattagacaaagaagttagggag
cgttttaaaaatgtagcgggagtgtag

DBGET integrated database retrieval system