KEGG   Helicobacter pylori 26695: C694_01165Help
Entry
C694_01165        CDS       T02282                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
heo  Helicobacter pylori 26695
Brite
Enzymes [BR:heo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     C694_01165
Secretion system [BR:heo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   C694_01165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
241196..241993
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQD
LKMVVIEDPDTKYNIPLVVSKDGNLIIGLSNIFFSNKSDDVQLVAETNQKVQALNATQQN
SAKLNAIFNEIPADYAIELPSTNAANKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGVIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagcgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacagaccaataaaaaggtgcgtattttagaaatcaaacctttaaaatctagccaggat
ttaaaaatggtcgttattgaagatccggacactaaatacaatatcccgcttgtggtgagt
aaggatggtaatttaatcatagggcttagcaacatattctttagcaataaaagcgatgat
gtgcaattagttgcagaaaccaatcaaaaagttcaagctcttaacgccacccaacaaaat
agcgcgaaattgaacgctatttttaatgaaataccggctgattatgcgatagagttgccc
tctactaacgctgcaaataaggataaaatcctttatattgtctctgatcccatgtgccca
cattgccaaaaagagctcactaaacttagggatcatttaaaagaaaacaccgtgagaatg
gtcgtggtggggtggcttggggtcaattcagctaaaaaagcggctttaatccaagaagaa
atggcgaaagctagggctaggggagcgagcgtggaagataagatctctattcttgaaaag
atttattccacccaatacgatattaacgctcaaaaagagcctgaagatttacgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcgtgattaagggtgtgcctttctta
taccattataaggcatga

DBGET integrated database retrieval system