KEGG   Helicobacter pylori 26695: C694_01395Help
Entry
C694_01395        CDS       T02282                                 

Definition
(GenBank) hypothetical protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
heo  Helicobacter pylori 26695
Pathway
heo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
heo01100  Metabolic pathways
heo01110  Biosynthesis of secondary metabolites
heo01130  Biosynthesis of antibiotics
heo01230  Biosynthesis of amino acids
Module
heo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:heo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C694_01395
Enzymes [BR:heo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     C694_01395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AFV41500
UniProt: O25053
Position
284423..284980
Genome map
AA seq 185 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQTKDCVFVTPDEVLEKLLK
ENTHTDCVIVNFKGLYEIGAPSVFNLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVVLDEELLKEDLKGMVEFSWRLGLSVFVETHKQDYTHLKDLGVLGVLEKVPHSQNQKR
IVFLD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgttaggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaactaaagattgtgtttttgtaacccctgatgaggttttagaaaagcttttgaaa
gaaaacacccataccgattgcgtcattgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttaatttagaagttttagggttattgcgccgccatgcgagttctttgatt
gtccatcaagatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcgttttagatgaagagcttttgaaagaagatttaaagggcatggtagaattt
tcttggcgtttgggcttgagcgtgtttgtagaaacccacaaacaagactacacccattta
aaagatttaggggttttaggcgtgctagaaaaagtcccccattctcaaaatcaaaaaaga
atagtctttttagattga

DBGET integrated database retrieval system