KEGG   Helicobacter pylori 26695: C694_03340Help
Entry
C694_03340        CDS       T02282                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
heo  Helicobacter pylori 26695
Pathway
heo00040  Pentose and glucuronate interconversions
heo00052  Galactose metabolism
heo00500  Starch and sucrose metabolism
heo00520  Amino sugar and nucleotide sugar metabolism
heo01100  Metabolic pathways
heo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:heo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    C694_03340
   00052 Galactose metabolism
    C694_03340
   00500 Starch and sucrose metabolism
    C694_03340
   00520 Amino sugar and nucleotide sugar metabolism
    C694_03340
Enzymes [BR:heo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     C694_03340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 P53_C
Motif
Other DBs
NCBI-ProteinID: AFV41867
UniProt: O25363
Structure
PDB: 

Jmol
Position
692054..692875
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHDHPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLEE
GVYEIKDMVEKPNQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALRTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgctgcgggctatggcacgcgctttttgccgatcact
aaaaccattcctaaagaaatgctgcccattgtggataaacctttaatccaatacgctgtg
gaagaagcgatggaagcgggctgtgaagtgatggcgatcgttacaggcagaaacaaacga
agtttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcactaac
aaagaaaacgccctaaaaagcattcgtaacattatagagaaatgctgtttttcctatgtg
cgccaaaagcaaatgaaaggcctagggcatgcgattttaaccggagaagccctcataggc
aatgagccttttgcggtgattttagccgatgacttgtgtataagccatgatcacccaagc
gtgttaaagcaaatgacttcattgtatcaaaaataccaatgctccattgtagccattgaa
gaagtggcgttagaagaagtttcaaaatacggcgtgattaggggcgaatggttagaagag
ggggtgtatgagattaaagacatggtagaaaaaccaaatcaagaagacgccccaagcaac
ctagccgtgatagggcgctacattttgactccggatatttttgaaattttaagcgagacg
aaaccgggtaaaaacaatgaaatccaaatcacagacgccttacgcactcaagccaaaaga
aagcgcatcatcgcttaccaattcaaaggcaaacgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcttataa

DBGET integrated database retrieval system