KEGG   Helicobacter pylori 26695: C694_03340Help
Entry
C694_03340        CDS       T02282                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
heo  Helicobacter pylori 26695
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:heo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    C694_03340
   00052 Galactose metabolism
    C694_03340
   00500 Starch and sucrose metabolism
    C694_03340
   00520 Amino sugar and nucleotide sugar metabolism
    C694_03340
Enzymes [BR:heo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     C694_03340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
692054..692875
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHDHPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLEE
GVYEIKDMVEKPNQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALRTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgctgcgggctatggcacgcgctttttgccgatcact
aaaaccattcctaaagaaatgctgcccattgtggataaacctttaatccaatacgctgtg
gaagaagcgatggaagcgggctgtgaagtgatggcgatcgttacaggcagaaacaaacga
agtttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcactaac
aaagaaaacgccctaaaaagcattcgtaacattatagagaaatgctgtttttcctatgtg
cgccaaaagcaaatgaaaggcctagggcatgcgattttaaccggagaagccctcataggc
aatgagccttttgcggtgattttagccgatgacttgtgtataagccatgatcacccaagc
gtgttaaagcaaatgacttcattgtatcaaaaataccaatgctccattgtagccattgaa
gaagtggcgttagaagaagtttcaaaatacggcgtgattaggggcgaatggttagaagag
ggggtgtatgagattaaagacatggtagaaaaaccaaatcaagaagacgccccaagcaac
ctagccgtgatagggcgctacattttgactccggatatttttgaaattttaagcgagacg
aaaccgggtaaaaacaatgaaatccaaatcacagacgccttacgcactcaagccaaaaga
aagcgcatcatcgcttaccaattcaaaggcaaacgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcttataa

DBGET integrated database retrieval system