KEGG   Helicobacter pylori 26695: C694_05430Help
Entry
C694_05430        CDS       T02282                                 

Definition
(GenBank) homoserine kinase
  KO
K00872  
homoserine kinase [EC:2.7.1.39]
Organism
heo  Helicobacter pylori 26695
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:heo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C694_05430
Enzymes [BR:heo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     C694_05430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1113035..1113916)
Genome map
AA seq 293 aa AA seqDB search
MVVSVPATSANLGPGFDCLGLSLNLRNRFFIEPSSFHAVKLVGEGEGIPKFLTNNIFTKV
FYEILKKHGNDGSFKFLLHNKVPITRGMGSSSAMIVGAVASAFAFLGFDFDRENIVNTAL
IYENHPDNITPAVFGGYNAAFVEKKKVISLKTKIPSFLKAVMVIPNRAISTKQSRHLLPK
RYSVQESVFNLSHASLMTMAIVQGKWDLLRCCSKDRMHQYKRMQTYPVLFAIQKIALENN
ALMSTLSGSGSSFFNMCYEEDAPKLKQVLSKKFPKFRVAVLDFDNDGVLIEKD
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttggtagtgagtgttcctgcaacaagtgcgaatttaggtcccggttttgattgcttgggt
ttgagtttgaatttacgcaatcggttttttattgagcctagcagtttccatgcggtgaaa
ttggttggggagggtgaagggatccctaagtttttaaccaacaatattttcactaaagtg
ttttatgagattttaaaaaagcatgggaatgacggctcgtttaaatttttattgcataat
aaagtccctattacaaggggcatggggtctagctcggcgatgattgtgggggcggtcgct
tcagcgtttgcgtttttagggtttgattttgatagagaaaacattgtcaataccgctcta
atttatgaaaaccacccggataatatcactccggcggtgtttggggggtataatgcagcg
tttgtggaaaaaaagaaagtgataagtttaaaaaccaaaatcccttcttttttaaaagcg
gtgatggtgatccctaatagggccatttccaccaagcaatcgcgccatctcttgcccaag
cgttacagcgtgcaagaaagcgtgtttaacctttcgcatgcgagtttgatgacgatggcg
attgtgcaggggaagtgggatttattgcgttgttgctctaaagacaggatgcatcaatat
aagcgcatgcaaacttaccccgtgttgtttgcgatccaaaagatcgctttagaaaataac
gccctaatgagcacgctttcagggagcggttcatcgttttttaacatgtgttatgaagaa
gacgcccctaaattaaagcaggttttgagcaagaaattccctaaatttagggtagcggtt
ttagattttgataatgatggggttcttattgagaaagactga

DBGET integrated database retrieval system