KEGG   Helicobacter pylori 26695: C694_05725Help
Entry
C694_05725        CDS       T02282                                 

Gene name
porA
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
heo  Helicobacter pylori 26695
Pathway
heo00010  Glycolysis / Gluconeogenesis
heo00020  Citrate cycle (TCA cycle)
heo00620  Pyruvate metabolism
heo00640  Propanoate metabolism
heo00650  Butanoate metabolism
heo00680  Methane metabolism
heo01100  Metabolic pathways
heo01120  Microbial metabolism in diverse environments
heo01130  Biosynthesis of antibiotics
heo01200  Carbon metabolism
Module
heo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:heo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C694_05725 (porA)
   00020 Citrate cycle (TCA cycle)
    C694_05725 (porA)
   00620 Pyruvate metabolism
    C694_05725 (porA)
   00640 Propanoate metabolism
    C694_05725 (porA)
   00650 Butanoate metabolism
    C694_05725 (porA)
  Energy metabolism
   00680 Methane metabolism
    C694_05725 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    C694_05725 (porA)
Enzymes [BR:heo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     C694_05725 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AFV42322
UniProt: O25738
Position
1171132..1172355
Genome map
AA seq 407 aa AA seqDB search
MAKSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYVDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFRIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGTMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIAHLCEIFEEINEDALKGTLTHPTQQFVGLHGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagtattgaattgcaagagatagaagtgtgggatggcaataccgctagttct
aacgctttaagacaggctcaaattgatgtcatcgcagcctatcctatcaccccatcaacg
cccattgtgcaaaattatggctcgtttaaggataatggctatgttgatggcgaattcgtt
ttagtggaatctgagcatgccgccatgagcgcatgcgtgggagctgccgcagctggaggg
agagtcagcactgcgactagctctcaaggtttggcgttaatggtagaggttttataccag
gcttctggaatgcgtttgcctatcgttttgaatttagtcaatcgtgctttagcagcccct
ttgaatatccatggcgatcattctgatatgtatttaagcagggattctggttggataagt
ttatgcacatgcaacccccaagaagcttatgatttcactttaatggcgtttagaatcgca
gagcatcaaaaggtgcgcgtgcctactattgtcaatcaagacgggtttttatgctcgcac
accgtgcaaaatgtccgccctttgagcgatgcagtggcttaccaattcgtgggcgaatac
caaaccaagcattcccttttggattttgataaaccggtaagctatggcgcgcaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgccatcatgagcgcgtcttct
gtgattgaagaagtgttcaatgatttcgctaaactcacaggcaggcaataccatttaacc
aaaactttccagctagaagacgctgaaatcgctatctttgcgttaggcactacttatgaa
tcagcgatcgtagcggctaaagaaatgcgtaaaaaaggcattaaggccggcgtggctacc
atccattccttgcgccccttcccttatgaaagattagggcaggatttgaaaaatcttaaa
gctttagcgattttagacaagagctctccagcgggcactatgggggcgatgtttaatgaa
gtaacgagcgcggtgtatcaaacgcaagggactaaacaccccgtggtgtctaactacatt
tatggtttaggcgaaagggatatgacgatcgcgcatttatgcgaaatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggcttgcac
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system