KEGG   Helicobacter pylori 26695: C694_06360Help
Entry
C694_06360        CDS       T02282                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
heo  Helicobacter pylori 26695
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:heo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    C694_06360
Enzymes [BR:heo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     C694_06360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1306014..1307156
Genome map
AA seq 380 aa AA seqDB search
MIVKRLNPDALKNALQKIGPEKIAQDRMHQKGVSFVFEIQHLPLSATLILKQEAISVGGD
FATPRDCILAKEPFYDGVLIASAKQLERLIVKCHSQPFGLKHLAQELKSHLKAPKPNTPQ
IMAVLNLTPDSFYEKSRFDSKKALEEIYQWLEKGITLIDIGAASSRPESEIIDPKIEQDR
LKEILLEIKSQKLYQCAKFSIDTYHATTAQMALEHYFSILNDVSGFNSAEMLEVAKDYKP
TCILMHTQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYVLQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQDRLAGTLSLHLMALQNGASVLRV
HDIDEHIDLIKVFKSLEETD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaaaacgccttaaccctgatgcgctcaaaaacgctctgcaaaaaataggccca
gaaaagatcgcgcaagatcgcatgcaccaaaaaggcgttagctttgtttttgaaatccaa
catctgcccttaagcgcaacgctcattttaaagcaagaggccataagcgttgggggcgat
tttgccacgccaagagattgtattttagccaaagagcctttttatgatggggtgttgatt
gcgagcgctaagcaattagaacgcctgattgttaagtgccactcccaaccctttgggctt
aaacatttagcgcaagaattaaaaagccacctcaaagcccctaagcctaacaccccacag
atcatggcagttttaaacttgactccggatagcttctatgaaaagagccggtttgatagc
aaaaaagcgcttgaagaaatctatcaatggctagaaaagggtatcacgctcattgatata
ggcgcggccagttcaaggccagagagtgaaatcattgatccaaaaatagagcaagatcgc
ttaaaagaaattttattagaaatcaaatcccaaaaactctaccaatgcgccaaattcagc
atagacacctaccatgccacaaccgcccaaatggctttggagcattatttttccatcctt
aatgatgtgagcggttttaatagcgctgaaatgctagaagtcgcaaaagattacaagccc
acttgcattttaatgcacactcaaaaaacccccaaagacatgcaagaaaatgttttttac
cacaatttatttgatgaaatggatcgcttctttaaggaaaaactagaagttttagaaaaa
tacgtgctccaagatattattttagatattgggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccactttctcaaattcaaaaaacccttattggtg
ggcgcgagtcgtaaaaacacgatcgggcttatcactgggcgtgaagttcaagaccggctc
gccggcactttgagtttgcatttaatggcgttgcaaaatggagcgagcgttttaagagtg
catgatattgatgagcatatagatttaatcaaagtgtttaagagtttggaagaaacggat
tga

DBGET integrated database retrieval system