KEGG   Helicobacter pylori 26695: C694_06600Help
Entry
C694_06600        CDS       T02282                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
heo  Helicobacter pylori 26695
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:heo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    C694_06600 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C694_06600 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C694_06600 (trpA)
Enzymes [BR:heo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     C694_06600 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1352382..1353170)
Genome map
AA seq 262 aa AA seqDB search
MRYQNMFETLKKHEKMAFIPFVTLGDPNYELSFEIIKTLIISGVSALELGLAFSDPVADG
ITIQASHLRALKHASMAKNFQLLKKIRDYNHNIPIGLLAYANLIFSYGVDGFYAQAKECG
IDSVLIADMPLIEKELVIKSAQKHQIKQIFIASPNASSKDLEQVATHSQGYIYALARSGV
TGASRILENDSSAIIKTLKAFSPTPALLGFGISKKEHITNAKGMGADGVICGSALVKIIE
ENLNNENAMLEKIKGFIGGMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatcaaaacatgtttgaaaccttaaaaaaacacgaaaaaatggcgtttatcccg
tttgtaaccttgggcgatcctaattatgaattgagttttgaaatcattaaaaccctaatt
attagcggggtgagcgctttagaattgggtcttgctttttctgatcctgtggcggatggc
attaccatacaagcgagccatttaagggcgttaaaacacgctagcatggctaaaaatttc
cagcttttaaaaaagattagagattacaaccacaatattcccatagggcttttagcgtat
gcgaatttaattttttcttatggcgttgatggcttttacgctcaagctaaagaatgcggt
atagatagcgttttaatagcggacatgcccctaatagaaaaagaattagtcatcaaatcc
gctcaaaaacaccaaatcaagcaaatctttatcgccagccccaatgcgagcagtaaagat
ttagaacaagtcgctacgcattcgcaaggctatatctacgctttagccaggagtggggtt
acaggggcgagccgtattttagagaatgattcgagtgctattattaaaaccttaaaagct
tttagccctaccccagccttactgggctttggcatttccaaaaaagaacacatcacaaac
gctaaaggcatgggtgctgatggcgtgatttgcggatcagcgttagtcaaaatcatagaa
gaaaatttaaacaatgaaaacgccatgctggaaaaaattaaagggtttataggaggaatg
attttttaa

DBGET integrated database retrieval system