KEGG   Helicobacter pylori 26695: C694_06610Help
Entry
C694_06610        CDS       T02282                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
heo  Helicobacter pylori 26695
Pathway
heo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
heo01100  Metabolic pathways
heo01110  Biosynthesis of secondary metabolites
heo01130  Biosynthesis of antibiotics
heo01230  Biosynthesis of amino acids
Module
heo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:heo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C694_06610
Enzymes [BR:heo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     C694_06610
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     C694_06610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AFV42497
UniProt: O25867
Position
complement(1354350..1355708)
Genome map
AA seq 452 aa AA seqDB search
MPSVLENILKDKLLEVSDLKKNHALPININPSDRDFKKALLEKKTSFILECKKASPSKGL
IRKDFDLLKITKTYEKFASCISVLADSKYFLGSYENIKIVSQHSTKPILCKDFIIDAFQI
KLARMMGANAVLLMLSVLDDKNYLELFNLAKSLNMSVLTEVSNQQEIEHLLKLQYDIIGI
NNRDLHTLKTDINHTLKLRPLLPKDALIISESGIYSHAQIKALAPYVNGFLVGSSLMKEK
DLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAV
KKLDFVGVFVKDSIKKIQKIVKKLDLKAVQLYGYSQKEIAQLKKALPKTCAIWQVISVMS
AKDLVPKTKEASLILYDTKGDKMGGNGVSFDWEILENVKTPFMLAGGLNLDNIQKALKVE
ALGLDFNSGLEISPGIKNKDKIKRLARILREY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtgttagaaaacatccttaaagacaagctcctagaagtctctgatcttaaa
aaaaaccacgctttaccgataaacataaacccaagcgatagggattttaaaaaggcgtta
ctagaaaaaaagaccagctttattttagaatgcaaaaaagcatcgccctctaaaggttta
atcagaaaagattttgatctgttaaaaataaccaagacttatgaaaaattcgcctcttgt
atttcggttttagccgattctaaatattttttaggctcttatgaaaacattaagatcgtt
tcgcagcattccaccaagcccattttgtgtaaagattttatcattgacgcttttcagatc
aaactcgctagaatgatgggggcgaatgcggtgcttttaatgttaagcgtgttagatgat
aaaaattatttagagcttttcaacctcgccaaatccttaaacatgagcgtgctgactgaa
gtttccaaccagcaagaaattgagcacttgctcaaactccaatacgacattataggcatc
aataacagggatttacacaccttaaaaaccgatattaaccacacgctcaaattacgcccc
ctgttgcctaaagatgcgctcattatcagtgagtccggtatttattcgcatgcacaaatc
aaagccctagccccttatgtgaatggctttttagtgggtagctctttgatgaaagaaaag
gatttgaaaaaagcgtgtattaaattgattttaggcgaaaataaagtgtgcgggcttaca
aggattaaagacgctaaagccgtttataaaaaccattttatttatgggggtttgattttt
gaaaaatcttcgccccgatacatcaagcctaaagaagccctaaaaatcacaaaagcggtt
aaaaaactggattttgtgggcgtgtttgtgaaagatagcattaaaaaaattcaaaaaatc
gttaaaaaacttgatttaaaagcggtgcagctttatggctattcgcaaaaagaaatcgct
caattgaaaaaagcactccctaaaacttgcgcgatctggcaagtaataagcgtgatgagt
gctaaagatttagtgcctaaaactaaagaggcctctctaatcttatacgacactaaaggg
gataaaatgggaggcaatggcgtgagttttgattgggaaattttagaaaatgtcaaaacg
cctttcatgctagctggggggcttaatttggataatattcaaaaagccttgaaagttgaa
gcgttgggtttggatttcaattccggtttagaaataagccctgggattaaaaataaggat
aaaatcaagcgattagcccgaattttaagagagtattaa

DBGET integrated database retrieval system