KEGG   Helicobacter pylori 26695: C694_07475Help
Entry
C694_07475        CDS       T02282                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
heo  Helicobacter pylori 26695
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:heo00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1514803..1515609
Genome map
AA seq 268 aa AA seqDB search
MTHVFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDKLKDIISVKSALSFSLKGDFDCPL
EENSLFKALQILKNFLKSKNFSHSVIKSLDTLAIEVEKNIPTQAGLGGGSTDAGGLLYHL
NQIFDWRLSLEELYSMGSLVGADTNFFISQYKSTNATSYGEVIENFEEEPLENRLEIYAP
NHVFCSTKAVYQAYKPETCFSQAKEWLKKPSLECLKTYDRNGLNDLLKPALLTNQALKDI
ESELGKEWFFSGSGSAFFRLKPMQKGGE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcatgtttttgaagtttatcctaaagtcaatatttttttaaaaatccttcacaaa
gaaggggcttaccacaagcttatttctcgcatgtgtttggtcaaagacaagctcaaagac
attatcagcgtcaaaagcgcgctttctttttcgttaaaaggggattttgactgcccttta
gaagaaaactcgctctttaaagccctccaaattttaaagaattttttaaaatcaaaaaat
ttctctcattctgtcatcaaatccctagacaccctagcgattgaagtggaaaaaaacatc
cccactcaagccggattaggcggtgggagcactgatgctggggggctattgtatcattta
aatcagatttttgactggcgtttgagtttagaagagctttatagcatgggatctttagtg
ggcgcggacaccaattttttcatctcgcaatacaaaagcactaacgccacttcttatggc
gaagtcattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatgcacca
aatcatgttttttgcagcaccaaagccgtttatcaagcttataagcctgaaacttgtttt
tctcaagctaaagaatggcttaaaaagccgagtttggaatgcctaaaaacttatgataga
aacggattaaacgaccttttaaagccggctttactcactaaccaagccttaaaagatata
gaaagcgaactaggcaaggagtggttttttagcgggagcgggagcgcgttttttaggcta
aagcctatgcaaaaagggggcgaatga

DBGET integrated database retrieval system