KEGG   Helicobacter pylori Puno120: HPPN120_00580Help
Entry
HPPN120_00580     CDS       T01919                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hep  Helicobacter pylori Puno120
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hep00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HPPN120_00580
Enzymes [BR:hep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HPPN120_00580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
115088..115726
Genome map
AA seq 212 aa AA seqDB search
MINMNTHTRGIDSNLIHSLKSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQL
NENTLLVLHDKMDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPR
DYLGYRSLGEEISIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgataaacatgaacacacacacaagaggcattgacagcaatctgattcattcgctcaaa
agcatttcattatccatgtttagaaagggcttttttgggctttatcaaggctctatctca
gcgcgcattggcacgaatcaatttgtgattaataaaagaaacgctgtttttgatcaactg
aatgaaaacaccttactggttttgcatgataagatggattatcgctggaaagaagcgagc
ctggattcgcccattcatgcgagcgtgtatagggagtttttggacgctaaattcatcgct
tatgcgcgccctccttatagtttggcgtattccttgcgccacaaccgattgctccctagg
gattatttagggtatcgttctttgggcgaagaaatttccattttcaaccccaaagactat
gacagctggcaagaaagagcggatacagaaattttacgccagctgcaagagagcaaaaaa
tattttgtcttcattaaggggtgtgggatttttgcctaccacagagagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgactgggcgatttaatg
gattattgctataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system