KEGG   Helicobacter pylori Puno120: HPPN120_00835Help
Entry
HPPN120_00835     CDS       T01919                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hep  Helicobacter pylori Puno120
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPPN120_00835
Enzymes [BR:hep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     HPPN120_00835
Exosome [BR:hep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPPN120_00835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(164420..165391)
Genome map
AA seq 323 aa AA seqDB search
MFKRLRRLRSSENLRAMLRETRLNINDFIAPLFVIESDSCIKNEISSMPGVYQMSIKPLL
KECEELVELGIKAVLLFGIPKHKDATGSHALNKDHIVAKATREIKKRFKDLIVIADLCFC
EYTDHGHCGILENDSVSNDKTLEILNLQGLILAESGVDILAPSNMMDGNVLSLRKTLDNA
GYFHTPIMSYSTKFASSYYGPFRDVANSAPSFGDRKSYQMDYANQKEALLESLEDEKQGA
DILMVKPALAYLDIVKEIRDHTLLPLALYNVSGEYAMLKLAQKHNLINYESILLETMTCF
KRAGADMIISYHAKEVANLLQRN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacgattgagaagattacgaagcagcgaaaatttaagagcgatgctaagagaa
acgcgtttaaatatcaatgatttcatcgctcccttatttgtcatagaaagcgatagttgt
attaaaaatgaaatcagttccatgcctggcgtgtatcaaatgagtataaagcctctttta
aaagaatgcgaagaattagtggagcttggcatcaaagccgttttattgtttggcattcct
aaacataaggacgctacaggaagccatgcgttaaataaggatcacattgtcgcaaaagct
acgagagaaattaaaaaacgatttaaggatttgattgttatagcggatttgtgtttttgt
gaatacaccgaccatgggcattgcgggattttagaaaacgattctgtgtctaacgataaa
acgctagagattttaaatcttcaagggcttattttagccgaaagcggcgtggatattcta
gccccaagcaacatgatggatgggaatgttttaagcttgagaaaaacgctagataacgcc
gggtattttcacacgcccatcatgagctattccactaaatttgcgagcagttattacggg
ccttttagagatgtggccaattctgcaccgagttttggcgatcgcaaaagctatcaaatg
gattacgctaatcaaaaagaagcgcttttagaaagtttagaagatgaaaagcagggtgcg
gatattttaatggtgaagccggctttagcgtatttggatattgttaaagaaattagagat
cacactttgctccctttagcgctctataacgtgagtggggaatacgccatgctcaaactc
gcgcaaaaacacaacctgatcaactatgaaagcattttgttagaaacgatgacttgtttt
aaaagagcgggagcggatatgattattagctatcatgctaaagaagtggctaacttatta
caaaggaattga

DBGET integrated database retrieval system