KEGG   Helicobacter pylori Puno120: HPPN120_01180Help
Entry
HPPN120_01180     CDS       T01919                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hep  Helicobacter pylori Puno120
Brite
Enzymes [BR:hep01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HPPN120_01180
Secretion system [BR:hep02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HPPN120_01180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
233727..234524
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQD
LKMVVIEDPDTKYNIPLVVSKDGNLVIGLSNIFFSNKSDDVQLVAETNQKVQALNATQQN
SAKLNAIFNEIPADYAIELPSTNAKNKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINDQKEPEDLRTK
VENTTKKIFESGMIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagcgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacaaaccaataaaaaggtgcgtattttagaaatcaaacctttaaaatccagccaggat
ttgaaaatggtcgttattgaagatccggacactaaatacaatattccgcttgtagtgagt
aaggatggtaatttagtcatagggcttagcaatatcttttttagcaataaaagcgatgat
gtgcaattagtcgcagaaaccaatcaaaaagtccaagcccttaacgctacccagcaaaat
agcgcgaaattgaacgctatttttaatgaaataccggctgattatgcgatagagttgccc
tctactaacgctaaaaataaggataaaatcctttatattgtttctgatcccatgtgcccg
cattgccaaaaagagctcactaaactcagggatcacttgaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggggtcaattcggctaaaaaagcggctttgatccaagaagaa
atggcgaaagctagggctaggggagcgagcgtggaagataaaatctctatccttgaaaag
atttattccacccaatacgatattaacgatcaaaaagagcctgaagatttacgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcatgattaagggtgtgcctttctta
taccattataaggcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system