KEGG   Helicobacter pylori Puno120: HPPN120_01395Help
Entry
HPPN120_01395     CDS       T01919                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hep  Helicobacter pylori Puno120
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPPN120_01395
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPPN120_01395
Enzymes [BR:hep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPPN120_01395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
275084..275626
Genome map
AA seq 180 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRIISKTRDCVFVTPDEVLGKFLE
ENTRTDCIVVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMAEFAWRLGLSVFVETHKLDYTHLKDLGVLGVLEKVPHSQNQKK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgctgggcaaaagcctgtcgtataacccttacttgcctagaattatt
tctaaaaccagagattgtgtttttgtaacccctgatgaggttttaggaaagtttttggaa
gaaaacacccgcaccgattgcatcgttgtcaatttcaaaggattatacgaaataggcgca
ccaagcgtgtttgatttagaagttttagggttattgcgccgccatgcgagctctttgatt
gtccatcaggatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcattttagacgaagagcttttgaaagaagatttaaagggcatggcagaattt
gcttggcgtttgggcttaagcgtgtttgtagaaacccacaagttagactacacccattta
aaagatttaggggttttaggcgtgctagaaaaagtcccccattctcaaaatcaaaaaaaa
tag

DBGET integrated database retrieval system