KEGG   Helicobacter pylori Puno120: HPPN120_02090Help
Entry
HPPN120_02090     CDS       T01919                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hep  Helicobacter pylori Puno120
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPPN120_02090
Enzymes [BR:hep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HPPN120_02090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
411749..412240
Genome map
AA seq 163 aa AA seqDB search
MMREILTSRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCFLYFKNHSKIGKIFSSP
VYINPPFGYTKQPNFYNATIILKTSLSLRHFFALVFYIERRFGRQRKRDFKDAPRTLDID
IIAFNQVILRQNDLTLPHLKWSERDSVLVPLALQQILFKKGEW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgagagatccttactagccgctttttccctagcctttttaaaaaaaggcttgat
ttttctaacagggtggttttagggctaggatctaatcttaaaaatcctttaaaaatatta
aaaaattgttttttatattttaaaaatcatagtaaaatcgggaaaattttttcttcgcct
gtttatatcaatccgccttttggttacacgaagcaacctaatttttataacgctacgatt
atccttaaaacatctttaagtttgcgccattttttcgctctggttttttatatagaaagg
cgttttgggcgccaaaggaagcgcgattttaaagacgctccaagaactttagacattgat
attatcgctttcaatcaagtcattttaagacagaacgatctgactttacctcatcttaaa
tggagtgaaagggattcggtgttagtgccgttggctttgcaacaaattctttttaaaaaa
ggggagtggtga

DBGET integrated database retrieval system