KEGG   Helicobacter pylori Puno120: HPPN120_02090Help
Entry
HPPN120_02090     CDS       T01919                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hep  Helicobacter pylori Puno120
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hep00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
411749..412240
Genome map
AA seq 163 aa AA seqDB search
MMREILTSRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCFLYFKNHSKIGKIFSSP
VYINPPFGYTKQPNFYNATIILKTSLSLRHFFALVFYIERRFGRQRKRDFKDAPRTLDID
IIAFNQVILRQNDLTLPHLKWSERDSVLVPLALQQILFKKGEW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgagagatccttactagccgctttttccctagcctttttaaaaaaaggcttgat
ttttctaacagggtggttttagggctaggatctaatcttaaaaatcctttaaaaatatta
aaaaattgttttttatattttaaaaatcatagtaaaatcgggaaaattttttcttcgcct
gtttatatcaatccgccttttggttacacgaagcaacctaatttttataacgctacgatt
atccttaaaacatctttaagtttgcgccattttttcgctctggttttttatatagaaagg
cgttttgggcgccaaaggaagcgcgattttaaagacgctccaagaactttagacattgat
attatcgctttcaatcaagtcattttaagacagaacgatctgactttacctcatcttaaa
tggagtgaaagggattcggtgttagtgccgttggctttgcaacaaattctttttaaaaaa
ggggagtggtga

DBGET integrated database retrieval system