KEGG   Helicobacter pylori Puno120: HPPN120_05345Help
Entry
HPPN120_05345     CDS       T01919                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hep  Helicobacter pylori Puno120
Pathway
hep00010  Glycolysis / Gluconeogenesis
hep00052  Galactose metabolism
hep00500  Starch and sucrose metabolism
hep00520  Amino sugar and nucleotide sugar metabolism
hep00521  Streptomycin biosynthesis
hep01100  Metabolic pathways
hep01110  Biosynthesis of secondary metabolites
hep01120  Microbial metabolism in diverse environments
hep01130  Biosynthesis of antibiotics
hep01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPPN120_05345 (glk)
   00052 Galactose metabolism
    HPPN120_05345 (glk)
   00500 Starch and sucrose metabolism
    HPPN120_05345 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPPN120_05345 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPPN120_05345 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HPPN120_05345 (glk)
Enzymes [BR:hep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPPN120_05345 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEN15661
UniProt: G2M3X0
Position
1094151..1095161
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLPCKDFESLSDAVRFYLSKCKESLK
LHPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLGLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacgaacgcgcgc
tttggcttggaagtcgccccacgacagattgaatgcattgaagtcttgccatgcaaagat
tttgaaagtttgagcgatgcggtgcgattttacctttctaaatgcaaagaaagccttaaa
ctgcaccctatttatggctcttttgcggtggctacgcccattatgggggattttgtccaa
atgactaacaaccactggactttttctattgaaacgacacggcaatgtttgggtttaaaa
aaattgcttgtcatcaacgattttgtcgcacaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgctcctaaagcgatttta
gggccaggaactgggcttggggtaagcactcttatccaaaacagcgatggctctttaaaa
gtcttgcccggtgaaggggggcatgtgagcttcgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaatcatgtgagcgcggaaaggtttttgagcggg
agcggtttggtgttgatttatgaggccctgtctaaacgcaaaggcttagaaaaagtggcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgactttggatactttttgctccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagggggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaaccccgggactt
gatggggcgggcattgcgttagagaattatttactgcatgataagatataa

DBGET integrated database retrieval system