KEGG   Helicobacter pylori Puno120: HPPN120_05380Help
Entry
HPPN120_05380     CDS       T01919                                 

Definition
pyruvate flavodoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
hep  Helicobacter pylori Puno120
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPPN120_05380
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPPN120_05380
   00020 Citrate cycle (TCA cycle)
    HPPN120_05380
   00620 Pyruvate metabolism
    HPPN120_05380
   00640 Propanoate metabolism
    HPPN120_05380
   00650 Butanoate metabolism
    HPPN120_05380
  Energy metabolism
   00680 Methane metabolism
    HPPN120_05380
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPPN120_05380
Enzymes [BR:hep01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPPN120_05380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1101320..1101880
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRIDDEPILN
HERFMQPDYVLVIDPGLVFIENIFANEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIGAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcacgagcgggtcaaggcgctatcaccggcgctaaaggg
ctggctgatgtgatttcaaaaacaggcaaagaagtgcaagcgttcgcttcctatggttca
gctaaaaggggggctgctatgatggcttataaccgcattgatgatgagcctattttaaac
catgaacgcttcatgcagcctgattatgtgctggtgattgatccgggtttggttttcatt
gaaaacatcttcgctaatgaaaaagaagacacgacctatatcatcactagttatcttaac
aaagaagaattgtttgaaaaaaaacccgaattaaaaacccgtaaggtgtttttagtggat
tgtttaaaaatctctatggaaaccctaaagcgccccatccctaacacacccatgctaggg
gctttaatgaaagtgtctggcatgcttgaaattggggcttttaaagaagcttttaagaaa
gttttgggcaaaaagctcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system