KEGG   Helicobacter pylori Puno120: HPPN120_05985Help
Entry
HPPN120_05985     CDS       T01919                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hep  Helicobacter pylori Puno120
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hep00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1231747..1232418
Genome map
AA seq 223 aa AA seqDB search
MREIVWVHSQRIAPYKTLILNELHYYPLELDLTPFNALIFTSKNAVFSLLETLNNSPKLK
TLQNIPAYALSEPTAKTLQDYHFKVAFIGKKAHGKEFAKEILPLLGKKSVLYLRAKEIAS
PLDTILLEHGINFQQAVVYENKLKHLTLSEQNALKPKEKSVLIFTAISHAKAFLHYFEFL
ENYTAISIGNTTASYLQEKGIPSYSAKKPSLEACLELALNLKS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagggagattgtatgggtgcattctcaaagaatcgccccttataagactctcatttta
aacgaattgcactactatcctttagaattggatttaaccccttttaacgccctgattttc
acctctaaaaatgcggtgttttccttgctagaaaccctaaacaacagccccaaactcaaa
acgttacaaaacattcctgcctacgctttgagcgaacccaccgcaaaaactctacaagat
taccattttaaagtcgcctttatagggaaaaaagcccatggcaaagagttcgccaaagaa
atccttcctttattgggaaaaaaaagcgttttgtatcttagggcaaaagaaattgcctct
cctttagacaccattcttttagagcatggcatcaatttccaacaagccgttgtttatgaa
aacaagctcaaacatttgactttaagcgaacaaaacgccctaaaacccaaagaaaagagc
gttctcattttcaccgctataagccatgcaaaagccttcttgcactattttgaattttta
gaaaattacaccgctatcagcattggcaacacgaccgcttcttatctacaagagaaaggc
attccaagctatagcgctaaaaagccctccttagaagcgtgtttagaactggctttaaat
ttgaaaagttaa

DBGET integrated database retrieval system