KEGG   Helicobacter pylori Puno120: HPPN120_06030Help
Entry
HPPN120_06030     CDS       T01919                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hep  Helicobacter pylori Puno120
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hep00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1237369..1238511
Genome map
AA seq 380 aa AA seqDB search
MILKRLNPDALKNALLKTGSEKCAQTHMHKKGVNFVFEIQHLPLSATLILKQEAISVGGD
FATPRDCILAKEPFYDGVLIVSASQLERLIAKCHSQPFGLKNLAQELKSHLKSPKPNNPQ
IMAILNLTPDSFYEKSRFDSKKALEEIYQLLEKGITLIDIGAASSRPQSEIIDPKIEQDR
LKEVLSEIKSQKLYQCAKFSIDTYHATTAQMALEHYFSILNDVSGFSSIEMLEVARDYKP
TCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYALQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQNRLAGTLSLHLMALQNGASILRA
HDIDEHIDLIKVFKSLEETN
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattttaaaacgccttaaccctgatgcgctcaaaaacgcccttttaaaaaccggatca
gaaaagtgcgctcaaacccatatgcataaaaaaggcgttaactttgtttttgaaatccaa
catctgcccttaagcgcaacgctcattttaaaacaagaggccatcagcgttgggggcgat
ttcgccacgccaagagattgtattttagctaaagagcctttttatgatggggtgttgatt
gtgagcgctagccagttagaacgccttattgccaagtgccattcccaaccctttgggctt
aaaaatttagcacaagaattaaaaagccaccttaaatccccaaaacctaacaacccacag
atcatggcgattttgaatctcacgccggatagtttttatgaaaagagccgttttgatagt
aaaaaagcacttgaagaaatctatcaattattagaaaagggtatcacgctcattgatata
ggcgcagccagttcaaggccacagagtgaaatcattgatccaaaaatagagcaagatcgc
ttaaaagaagttttatcagagatcaaatcccaaaaactctaccaatgtgctaaattcagc
atagacacctaccatgccacaaccgcccaaatggctttggagcattatttttccatcctt
aatgatgtgagtggttttagtagtattgaaatgctagaagtcgccagagattacaaaccc
acttgcattttaatgcacgctcaaaaaacccccaaagacatgcaagaaaatgtcttttac
cacaatttatttgatgaaatggatcgtttctttaaggaaaaactagaggttttagaaaaa
tacgcgcttcaagatattattttagatatagggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccacttcctcaaattcaaaaaacccttattggtg
ggagcgagtcgtaaaaacacgatcgggcttatcaccgggcgtgaagttcaaaaccggctc
gccggcactttaagcttgcatttaatggcgttacaaaatggagcgagcattttaagagcg
catgacattgatgagcatatagatctcatcaaggtgtttaagagtttagaagaaacaaat
tga

DBGET integrated database retrieval system