KEGG   Helicobacter pylori Puno120: HPPN120_06270Help
Entry
HPPN120_06270     CDS       T01919                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hep  Helicobacter pylori Puno120
Pathway
hep00010  Glycolysis / Gluconeogenesis
hep00030  Pentose phosphate pathway
hep00051  Fructose and mannose metabolism
hep00052  Galactose metabolism
hep00230  Purine metabolism
hep00500  Starch and sucrose metabolism
hep00520  Amino sugar and nucleotide sugar metabolism
hep00521  Streptomycin biosynthesis
hep01100  Metabolic pathways
hep01110  Biosynthesis of secondary metabolites
hep01120  Microbial metabolism in diverse environments
hep01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPPN120_06270
   00030 Pentose phosphate pathway
    HPPN120_06270
   00051 Fructose and mannose metabolism
    HPPN120_06270
   00052 Galactose metabolism
    HPPN120_06270
   00500 Starch and sucrose metabolism
    HPPN120_06270
   00520 Amino sugar and nucleotide sugar metabolism
    HPPN120_06270
  Nucleotide metabolism
   00230 Purine metabolism
    HPPN120_06270
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPPN120_06270
Enzymes [BR:hep01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPPN120_06270
    5.4.2.8  phosphomannomutase
     HPPN120_06270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AEN15844
UniProt: G2M480
Position
1281428..1282804
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKSAFSIGVELGKIMREYDKSVFVGHDARVHGRSLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEIDNIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEIKPLKETPKKANALEAYQRYLIKDFEHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPDGNFPNHHPDPSEAKNLQDLEKHMQENAISIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINAFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQTPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQEALKNPPNNFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDEATALEYKKALLNLLEE
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagggagtatgatattagaggcatttaccccaccactttagat
gaaaagagcgcctttagtatcggcgtggagttagggaaaatcatgcgagaatacgataaa
agcgtgtttgtagggcatgacgccagggtgcatgggcgatcgctttttgaagctttgagc
gccgggctacaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatagacaatatccaatgccccaattccatcatgatc
actggttctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggacattcaagctttaaaagacacgcttttaaacgccaagcatgaaata
aaacccctaaaagaaacaccaaagaaagccaatgccctagaagcgtatcagcgctatttg
atcaaggattttgagcatttaaaaaaccttaaatacaaaatcgccctggattttggtaat
ggcgtgggagcgttaggcttagagcctattttaaaggctttaaacattgattttagcagt
ctttatagcgatcctgatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttacaagatttagaaaaacacatgcaagaaaacgctatttctataggctttgctttt
gatggcgatgcggacaggattgcgatgttaagctctcatcatatttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgatcaatgcttttggcaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgctattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgcttgaacaaaccccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacctgcaagaagcgcttaaaaacccgccaaataat
ttccctaaaatcaaagaaataatcagtattgatggcgtgagggtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccactccgtatttagtcagccgctttgaaggcaag
gatgaagctacagcgttagagtataaaaaagcgctactcaatttgctagaggaataa

DBGET integrated database retrieval system