KEGG   Helicobacter pylori Puno120: HPPN120_06280Help
Entry
HPPN120_06280     CDS       T01919                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hep  Helicobacter pylori Puno120
Pathway
hep00260  Glycine, serine and threonine metabolism
hep00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hep01100  Metabolic pathways
hep01110  Biosynthesis of secondary metabolites
hep01130  Biosynthesis of antibiotics
hep01230  Biosynthesis of amino acids
Module
hep_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hep00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPPN120_06280 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPPN120_06280 (trpA)
Enzymes [BR:hep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPPN120_06280 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: AEN15846
UniProt: G2M482
Position
complement(1283495..1284283)
Genome map
AA seq 262 aa AA seqDB search
MRYKTMFEILKKQDKMAFIPFVTLGDPNYAWSFEIIKTLIASGVSALELGFAFSDPVADG
ITIQASHLRALKHASMAKNFQLLRAIRDYNPHIPIGLLAYANLIFSYGVDNFYAQIKECG
VDSILIADMPLIEKELVLKSAQKHQIKQIFIASPNASNKDLEQAAMHSQGYIYTLARSGV
TGASCILENDASAIIKTLKTFSPTPALLGFGISKKEHIKNAKGMGADGVICGSALVKIIE
ENLNDENAMLEKIKGFVGEMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtataaaaccatgtttgaaatcttaaaaaaacaagacaaaatggcgtttatcccg
tttgtaaccttgggcgatcctaattatgcatggagttttgaaatcattaaaaccttaatt
gctagcggggtgagcgctttagaattgggctttgctttctcagacccggtagcggatggc
attaccatacaagcgagccatttaagggcgttaaaacacgctagcatggctaaaaatttc
cagcttttaagggcgatcagagattacaatccccacattcccatagggcttttagcgtat
gcgaatctcattttttcttatggcgtggataatttttacgcccaaatcaaagaatgcggc
gtggatagcattttaatagcggacatgcccctaatagaaaaagaattagtcctaaaatcc
gctcaaaaacaccagattaaacaaatctttatcgccagccccaatgcgagtaataaagat
ttagaacaagccgctatgcattcgcaaggctatatctacactctggctaggagtggggtt
acaggagcgagctgtattttagaaaatgacgcgagcgctattattaaaaccttaaaaacc
tttagccccacaccggccttattgggctttggcatttctaaaaaagaacacataaaaaac
gctaaaggcatgggcgctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaa
gaaaatttgaacgatgaaaacgccatgctagaaaaaattaaagggtttgtgggagaaatg
attttttaa

DBGET integrated database retrieval system