KEGG   Helicobacter pylori Puno120: HPPN120_06285Help
Entry
HPPN120_06285     CDS       T01919                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hep  Helicobacter pylori Puno120
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPPN120_06285
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPPN120_06285
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPPN120_06285
Enzymes [BR:hep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPPN120_06285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1284280..1285461)
Genome map
AA seq 393 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQKEYFHLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLGLKCVIFMGAKDIKRQEMNVFRMRLLGAEIREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIIESHSISA
GLDYPGVGPEHSYLKESARAIYESASDLEALEAFSLLCQKEGIIPALESSHALVHALKLA
QKCEEESIIVVNLSGRGDKDLSTVYNALKGGLK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcagaattgttagtg
cctgcattaagagagttagaacaggcgtttgatgcgtgtttgaaagatgaaaaattccaa
aaagaatatttccatcttttaaaagattttgtgggccgtcctagccccttaaccttgtgt
caaaatatcgtttctaaccctaaagttaagctttatctaaaacgagaagatttaatccat
ggcggagcacacaagactaatcaggctttagggcaagcccttttagcgaaaaaaatgggt
aaaacaaggattattgctgaaacaggtgctgggcagcatggcgtggcgacggctatcgct
tgcgcgttattgggtttaaaatgcgtgatttttatgggggctaaagacatcaagcgccag
gaaatgaatgtttttagaatgcgtttattaggcgctgaaataagagaggttaattcaggg
agcgcgacgcttaaagacgctgtgaatgaagccttaagggattgggcgagcagttacaag
gacacgcattatttgttgggcacagccgccgggccacacccttaccctacgatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccaaattctagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctataggaatatttagc
gcgtttttaaacgataaagaggttaaactcataggcgtagagccggcgggtttagggcta
gaaaccaataagcatggggcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattatagaaagccatagcattagcgct
gggcttgattatccaggagtggggccagaacacagctatttaaaagagagcgctcgcgcg
atttatgaaagcgcaagcgatcttgaagcgctagaagcctttagtttgttgtgccaaaaa
gaaggcattatcccagcgctagaaagctcacacgctttagtgcatgccttaaaactcgct
caaaaatgcgaagaagaaagcatcatcgtagtgaatttaagcggtcggggggataaggat
ttaagcaccgtttataacgctttaaaaggaggtttaaaatga

DBGET integrated database retrieval system