KEGG   Helicobacter pylori Puno120: HPPN120_07045Help
Entry
HPPN120_07045     CDS       T01919                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hep  Helicobacter pylori Puno120
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hep00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPPN120_07045
Enzymes [BR:hep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HPPN120_07045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1418738..1419541
Genome map
AA seq 267 aa AA seqDB search
MHAFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDRFKDIISVKSALSFSLKGDFDCPLE
ENSLFKALQILKNFLKSKNFSHSAIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHLN
QIFDWRLSSEELYNMGSLVGADTNFFISQHKSANATSYGEVIENFEEEPLENRLEIYTPN
HVFCSTKAIYQAYKPETCFSQAKEWLKKPSLECLKTCDRNELNDLLKPALLTNQALRGIE
SELGKEWFFSGSGSAFFRLKPALKEGE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcctttgaagtttatcctaaagtcaatatttttttaaaaatccttcacaaagaa
ggggcttatcataagctcatttctcgcatgtgtttggtcaaagatagattcaaagatatt
atcagcgtcaaaagcgcgctttccttttcattaaaaggggattttgactgccctttagaa
gaaaactcgctctttaaagccctccaaattttaaaaaattttttaaaatcaaaaaatttc
tctcattctgccatcaaatccctagacaccctagcgattgaagtggaaaaaaacatcccc
actcaagccggattaggcggtgggagcgctgatgctggggggctattgtatcatttgaat
caaatttttgactggcgtttgagttcagaagagctttataacatgggatctttagtgggt
gcagacaccaactttttcatctcgcaacacaaaagcgctaacgccacttcttatggcgaa
gttattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatacgccaaac
catgttttttgcagcactaaagccatttatcaagcctataagcctgaaacttgtttttct
caagctaaagagtggcttaaaaagccgagtttagaatgcctaaagacttgcgacaggaac
gaattaaacgatcttttaaaaccggctttactcactaaccaagccttaagaggcatagaa
agtgaactgggcaaggagtggttttttagcgggagtgggagcgcgttttttaggctaaag
cctgcgttaaaagagggcgaatga

DBGET integrated database retrieval system