KEGG   Helicobacter pylori Puno120: HPPN120_07320Help
Entry
HPPN120_07320     CDS       T01919                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
hep  Helicobacter pylori Puno120
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hep00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hep00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1470733..1472076
Genome map
AA seq 447 aa AA seqDB search
MKLKKTLTYQNHTYSFLSDNTHEVLENPKEILFVKTPLNEKYSPFIAEKNLAILDFNELK
NYFDFKMKIVGITGTNGKTTTASLMYSLLLDLNKKTALLGTRGFFINDKRIKEKGLTTPT
LLELYSDLEEAMRLKCEYFIMEVSSHAIVQKRIAGLDFALKILTNITSDHLDFHESIENY
KDAKNSFFKDEGLKVINRDETNALFNPINAHTYALDKKAHLNIQAFSLTPSISASLCYQQ
DLRNPNLKEIALMHSPLLGRYNLYNILASVLGVKLLTQLALEAIAPLLENFYGVKGRLEI
VHSKPLVIVDFAHTIDGMQQVFESFKNQKITALFGAGGDRDKTKRPKMGEVASYYAHKIV
LTSDNPRSENEEDIIKDILKGISDSSKVVIEKDRKKAILNALENLKDDEVLLILGKGDEN
TQIFKDKTIFFSDQEVVKSYYQHLKQG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttaaaaaaaccctgacttatcaaaaccacacctattcttttttaagcgataac
acgcatgaagttttagaaaaccctaaagaaatcctttttgtcaaaacgcctttaaatgaa
aaatactctcctttcattgcagaaaaaaacctagctattttagattttaacgagcttaaa
aactattttgattttaaaatgaaaattgtagggattactggcactaatggcaaaacgacc
acagcgagtttgatgtattccttactcttagatttgaataaaaagaccgctcttttaggc
acaagagggttttttatcaatgacaaacgaatcaaagaaaagggtttgaccacgcccact
cttttagagctttatagcgatttagaagaagcgatgcgtttaaaatgcgaatactttatt
atggaagtgagctcccatgcgattgtccaaaagcgcattgccgggcttgattttgctctt
aaaatcctcactaatatcacaagcgatcatttagatttccacgaaagcatagaaaattac
aaagacgccaaaaacagcttttttaaagatgaaggcttgaaagtgattaacagagatgaa
acaaacgccctttttaaccccattaacgcgcacacttacgcgctggataaaaaagcgcat
ttaaacattcaagccttttcgctcaccccctccattagcgcatctttatgctaccaacaa
gatttaagaaatcctaatctcaaagaaatcgctcttatgcattccccccttttagggcgt
tacaacctttataatatcttagcgagcgttttaggggtcaaattactcacccaattagcg
ctagaagcgattgcgccgttattagaaaacttttatggggttaaggggcgtttggaaatt
gtgcattctaaacctttagtgatcgtggattttgcccacaccatagacggcatgcaacaa
gtctttgaaagctttaaaaaccaaaaaatcaccgctctttttggagcaggaggcgatagg
gacaagaccaagcgccctaaaatgggggaagtagcgagctattacgctcataaaatcgtc
ttaacttcagacaaccccagaagcgaaaacgaagaagacattattaaggatattttaaaa
ggcatcagcgattcttctaaagtggttatagaaaaagaccgaaaaaaagccattttaaac
gctttagaaaatttaaaagacgatgaggtgttattgattttaggcaagggcgatgaaaac
actcaaatctttaaagacaaaacgattttttttagcgaccaggaagtcgttaaaagctat
taccaacatttaaaacaaggataa

DBGET integrated database retrieval system