KEGG   Helicobacter pylori Puno120: HPPN120_07685Help
Entry
HPPN120_07685     CDS       T01919                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hep  Helicobacter pylori Puno120
Pathway
hep00220  Arginine biosynthesis
hep00330  Arginine and proline metabolism
hep01100  Metabolic pathways
hep01110  Biosynthesis of secondary metabolites
hep01130  Biosynthesis of antibiotics
hep01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hep00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HPPN120_07685
   00330 Arginine and proline metabolism
    HPPN120_07685
Enzymes [BR:hep01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPPN120_07685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEN16112
UniProt: G2M6Y0
Structure
PDB: 

Jmol
Position
complement(1556381..1557322)
Genome map
AA seq 313 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREVLSATHGDVIKGMQTIIQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMREVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGALEIDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRENMQEVVQKTKESLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFNELKQLLGLLLESFKDRLGAVEVTEYNPTVSAKHTNEEERQVLE
ILDLIINSCKIKD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattagaagcagaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagttttaagtgcaacgcatggcgatgtgattaaaggcatgcaa
acgatcattcaagagcggtgcgtgctttataaagaatttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgcgagaagtgtttgagaaa
aaagaatttcctttgattttaagctcagagcatgcgaacatgtttgggatttttcaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagcgggtttaaccgcatgagcgagagcgaagaaaaggcatggcaa
aagctctgctctttggggttagaaaagggagcgttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattaaggaattgcaaatc
cctttatttagcgtggaagcgataagagaaaacatgcaagaagtggttcaaaaaactaaa
gaatcattgaaagcggtggatattatttaccttagtctagatttagacattatggatggc
aagctcttcacttctaccggcgtgcgtgaaaataacgggctgagttttaatgagctaaag
caattactgggcttgcttttagaaagctttaaagacagattaggggctgttgaggtaacc
gaatacaaccccacggtgagcgcaaaacacaccaacgaagaagaaaggcaggttttagag
atattagatctcatcatcaatagctgtaaaattaaagattaa

DBGET integrated database retrieval system