KEGG   Helicobacter pylori Puno120: HPPN120_07685Help
Entry
HPPN120_07685     CDS       T01919                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hep  Helicobacter pylori Puno120
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPPN120_07685
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HPPN120_07685
Enzymes [BR:hep01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPPN120_07685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1556381..1557322)
Genome map
AA seq 313 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREVLSATHGDVIKGMQTIIQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMREVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGALEIDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRENMQEVVQKTKESLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFNELKQLLGLLLESFKDRLGAVEVTEYNPTVSAKHTNEEERQVLE
ILDLIINSCKIKD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattagaagcagaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagttttaagtgcaacgcatggcgatgtgattaaaggcatgcaa
acgatcattcaagagcggtgcgtgctttataaagaatttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgcgagaagtgtttgagaaa
aaagaatttcctttgattttaagctcagagcatgcgaacatgtttgggatttttcaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagcgggtttaaccgcatgagcgagagcgaagaaaaggcatggcaa
aagctctgctctttggggttagaaaagggagcgttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattaaggaattgcaaatc
cctttatttagcgtggaagcgataagagaaaacatgcaagaagtggttcaaaaaactaaa
gaatcattgaaagcggtggatattatttaccttagtctagatttagacattatggatggc
aagctcttcacttctaccggcgtgcgtgaaaataacgggctgagttttaatgagctaaag
caattactgggcttgcttttagaaagctttaaagacagattaggggctgttgaggtaacc
gaatacaaccccacggtgagcgcaaaacacaccaacgaagaagaaaggcaggttttagag
atattagatctcatcatcaatagctgtaaaattaaagattaa

DBGET integrated database retrieval system