KEGG   Helicobacter pylori F32: HPF32_0110Help
Entry
HPF32_0110        CDS       T01911                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
heq  Helicobacter pylori F32
Pathway
heq00260  Glycine, serine and threonine metabolism
heq00750  Vitamin B6 metabolism
heq01100  Metabolic pathways
heq01110  Biosynthesis of secondary metabolites
heq01120  Microbial metabolism in diverse environments
heq01230  Biosynthesis of amino acids
Module
heq_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:heq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPF32_0110 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPF32_0110 (thrC)
Enzymes [BR:heq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPF32_0110 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: BAJ57692
UniProt: E6NMW6
Position
complement(109521..110981)
Genome map
AA seq 486 aa AA seqDB search
MPFVPTRSLKEKKIDFIEAILNPNAPKGGLYTLEHFETLQWQDCLNLSYNELVECVFEHL
GLEIPKGLLTSALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNVLKNLLKDDDFNGALKARQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTYSPAMDILKSSNVERVLFDLFGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDKACLKTIQEVYAEHQYLIDPHTATALNASLKTNEKTLVSATASYEKFP
RTTLLALNEQKKNDNDKTALETLKNSYNTLDSQRLDDLFERGIKHQEVLKLNEIKSSILL
WLENTH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccctacgcgttctttgaaagaaaaaaagattgattttattgaagcaata
ttaaaccccaacgccccaaaaggtgggctttacactttagagcattttgaaacattacaa
tggcaggattgtttgaatctgagctataacgagctggtagaatgcgtgtttgagcacttg
ggtttagagattcctaagggtttattgacaagcgctttaaaacgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcgctcaatgaaaggctttttgtccaagagctc
taccatgggcctagtttggcgtttaaagacatggcgttacagcctttagcgagcttgttt
tctaatctagcggtaggaaaaaatgaaaagtatttgatgctcgtttctaccagtggcgat
accggccctgcgactttagaaagtttggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttagtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttggaatcagtggggattttgatgatgcgcaaaacgtgctcaaaaac
cttttaaaagacgatgattttaacggcgctttaaaagcgcgccaattaaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgctttaggggcgttttatgccaaaaaaatgggcttgaatatt
gctaaaatcaaggttgtaaccaacagcaatgatgttttaagggagtttatagaaacaggg
cgttacgatttaacccatcgttctttaaagcaaacctactcgccggctatggatatttta
aaaagctctaatgtggaaagggtgctttttgacctctttgggtttgaacgcacgctagag
ttgatgcaagctttagaagaagagaaattttacgcattaaagcctaaagaattagccctt
ttacaggagcatttttcttgtgcgagctgctcagataaagcttgtttgaaaaccatccaa
gaagtttatgcagagcaccaatacctgattgacccccacaccgccaccgctttaaacgcc
agcttgaaaaccaatgaaaaaacccttgtttctgccaccgcctcttatgaaaaattccct
agaaccacccttttagccctaaacgagcaaaagaaaaacgataacgacaaaaccgcccta
gaaacgcttaaaaacagctacaataccctagatagccagcgccttgatgatttatttgaa
agaggaatcaagcaccaagaagttttaaaactcaatgagatcaaatcttctatccttttg
tggctagaaaacacgcactaa

DBGET integrated database retrieval system