KEGG   Helicobacter pylori F32: HPF32_0123Help
Entry
HPF32_0123        CDS       T01911                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
heq  Helicobacter pylori F32
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:heq00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HPF32_0123
Enzymes [BR:heq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HPF32_0123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
126174..126803
Genome map
AA seq 209 aa AA seqDB search
MNTHTRGIDSNLIHSLQSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQLNEN
TLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPRDYL
GYRSLGEEISIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKLMEV
FDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacacacaagaggcattgacagcaatctgattcattcgctccaaagcatttca
ttatccatgtttagaaagggtttttttgggctttatcaaggctctatttcagcgcgcatt
ggcacgaatcaatttgtgatcaataaaagaaacgctgtttttgatcaattgaatgaaaac
accttgttagttttgcatgataagattgattaccgttggaaagaagcgagtctggattcg
cccattcatgcgagcgtgtatagggagtttttggacgctaaattcatcgcttatgcgcgc
cctccttatagtttggcgtattccttgcgccacaaccgattgctccctagggattattta
gggtatcgttctttgggcgaagaaatttccatttttaaccccaaagactatgacagctgg
caagaaagagcggatacagaaattttacgccaactgcaagagagcaaaaaatattttgtt
ttcattaaggggtgtgggatttttgcctaccacagagagctttctaaactcatggaagtt
tttgatttgattgaaaactcatgcaaggttttacgactgggcgatttaatggattattgc
tataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system