KEGG   Helicobacter pylori F32: HPF32_0171Help
Entry
HPF32_0171        CDS       T01911                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
heq  Helicobacter pylori F32
Pathway
heq00860  Porphyrin and chlorophyll metabolism
heq01100  Metabolic pathways
heq01110  Biosynthesis of secondary metabolites
heq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:heq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPF32_0171 (hemB)
Enzymes [BR:heq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     HPF32_0171 (hemB)
Exosome [BR:heq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPF32_0171 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: BAJ57753
UniProt: E6NN27
Position
complement(174148..175119)
Genome map
AA seq 323 aa AA seqDB search
MFKRLRRLRSSENLRAMLRETRLNVDDFIAPLFVIESDSYIKNEINSMPGVYQMSIEPLL
KECEELVGLGIKAVLLFGIPKHKDATGSHALNKDHIVAKATKEIKKRFKDLIVIADLCFC
EYTDHGHCGILENASVSNDKTLEILNLQGLILAESGVDILAPSNMMDGNVLSLRKTLERA
GYFHTPIMSYSTKFASSYYGPFRDVANSAPSFGDRKSYQMDYANKKEALLESLEDEKQGT
DILMVKPALAYLDIVKEIRDHTLLPLALYNVSGEYAMLKLAQKHNLINYESVLLETMTCF
KRAGADMIISYHAKEVANLLQRN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacgattgagaagattacgaagcagcgaaaacttaagggcgatgctaagagaa
acgcgtctgaatgttgatgacttcatcgctcccttatttgtcatagaaagcgatagttat
attaaaaatgaaatcaactccatgcctggcgtttatcaaatgagcatagagcctctttta
aaagaatgcgaagaattagtgggtttaggcatcaaagccgttttattgtttggcattcct
aaacataaggacgctacaggaagccatgcgttaaataaggatcatattgtcgcaaaagcc
accaaagagattaaaaaacgatttaaggatttaatcgttatagcggatttgtgtttttgt
gaatacaccgaccatgggcattgcgggattttagaaaacgcttctgtgtctaacgataaa
acgctagagattttaaaccttcaagggcttattttagctgaaagcggtgtggatattcta
gccccaagcaacatgatggatgggaatgttttaagcttgagaaaaacgctagaaagggcc
gggtattttcacacgcccatcatgagctattccactaaatttgcgagcagttactatggg
ccttttagagatgtggcaaactctgcaccgagttttggcgatcgcaaaagctatcaaatg
gattacgctaataaaaaagaagcgcttttagaaagtttagaagatgaaaaacagggcacg
gatattttaatggtgaaaccggctttggcgtatttggatattgttaaagaaatcagagat
cacactttgctccctttagcgctctataatgtgagcggggaatacgccatgctcaaactc
gctcaaaaacacaacctgatcaactatgaaagcgttttattagaaacgatgacttgcttt
aaaagagcgggagcagatatgattattagctatcatgccaaagaagtggctaacttatta
caaaggaattga

DBGET integrated database retrieval system