KEGG   Helicobacter pylori F32: HPF32_0193Help
Entry
HPF32_0193        CDS       T01911                                 

Gene name
glyA
Definition
serine hydroxymethyltransferase
Orthology
K00600  
glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
heq  Helicobacter pylori F32
Pathway
Glycine, serine and threonine metabolism
Cyanoamino acid metabolism
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:heq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPF32_0193 (glyA)
   01230 Biosynthesis of amino acids
    HPF32_0193 (glyA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HPF32_0193 (glyA)
  Energy metabolism
   00680 Methane metabolism
    HPF32_0193 (glyA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPF32_0193 (glyA)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    HPF32_0193 (glyA)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    HPF32_0193 (glyA)
Enzymes [BR:heq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     HPF32_0193 (glyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
194852..196102
Genome map
AA seq 416 aa AA seqDB search
MAYFLEQTDSEIFELIFEEYKRQNEHLEMIASENYTFASVMEAMGSVLTNKYAEGYPNKR
YYGGCEVVDKIESLAIERAKKLFNCQFANVQAHSGSQANNAVYHALLKPYDKILGMDLSC
GGHLTHGAKVSLTGKHYQSFSYGVNLDGYIDYEEALKIAQSVKPEIIVCGFSAYPREIDF
KKFREIADEVGALLLGDIAHVAGLVVTGEHANPFPHCHVVSSTTHKTLRGPRGGLILTND
EEIAAKIDKAIFPGTQGGPLMHVIAAKAVGFKENLKPEFKAYAQLVKSNMQVLAKALQEK
NHKLVSGGTSNHLLLMDFLDKPYSGKDADIALGNAGITVNKNTIPGETRSPFVTSGIRIG
SAALSARGMGAKEFEIIGNKISDILNDINNVSLQLHVKEELKAMASQFPVYQQPIF
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcgtattttttagaacaaacggatagtgaaatttttgagcttatctttgaagaatac
aagcggcaaaacgaacatttagaaatgatagcgagcgagaattacacttttgcaagcgtt
atggaggctatggggagtgttttgacgaataaatacgctgaaggctatcctaacaagcgc
tactatggaggctgtgaagtggtggataaaatagaaagcttggccatagaaagggctaaa
aagctttttaattgccagttcgctaatgtgcaagcgcactcaggctcacaagccaataac
gctgtctatcacgctcttttaaagccttatgacaagattttaggcatggatttaagctgt
ggagggcatttaacgcatggcgctaaagtgagcttaaccggcaagcattatcagagcttt
tcttatggcgtgaatttagatggctatattgattatgaagaagcgctaaaaatcgctcaa
agtgttaagccagaaatcattgtgtgcggattttcagcctatccaagggagattgatttt
aagaaatttagagaaatcgctgatgaagtgggagcgttattattaggcgatatagcccat
gtggcagggcttgtggtaaccggtgagcatgctaatcctttcccgcattgccatgtggtt
tcaagcaccactcataagaccttaagagggcctagaggggggcttattttaaccaatgat
gaagagatagcggctaagattgataaagcgatttttccaggaactcaaggcgggcctttg
atgcatgtaattgctgctaaagcggtgggatttaaagagaatctgaaaccagaatttaaa
gcttatgcacaattagtgaaatctaacatgcaagttttggctaaagcgttacaagaaaaa
aaccataagttagtgagtggtggcacttctaaccatttgcttttaatggatttcttggat
aagccttatagcgggaaagacgctgatattgcattagggaatgccggaatcaccgtgaat
aaaaacaccattcctggcgaaacgcgtagcccttttgtaacgagcgggataaggattggc
tcagcggcattgagcgcaaggggcatgggagctaaggaatttgaaatcatagggaataaa
atatcagatattttgaatgatattaataatgttagtttgcaattgcatgtgaaagaagaa
ttgaaagccatggctagtcaattccctgtgtatcaacaacctattttttaa

DBGET integrated database retrieval system