KEGG   Helicobacter pylori F32: HPF32_0202Help
Entry
HPF32_0202        CDS       T01911                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
heq  Helicobacter pylori F32
Pathway
heq00010  Glycolysis / Gluconeogenesis
heq00051  Fructose and mannose metabolism
heq01100  Metabolic pathways
heq01110  Biosynthesis of secondary metabolites
heq01120  Microbial metabolism in diverse environments
heq01130  Biosynthesis of antibiotics
heq01200  Carbon metabolism
heq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:heq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPF32_0202 (tpiA)
   00051 Fructose and mannose metabolism
    HPF32_0202 (tpiA)
   00562 Inositol phosphate metabolism
    HPF32_0202 (tpiA)
Enzymes [BR:heq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HPF32_0202 (tpiA)
Exosome [BR:heq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HPF32_0202 (tpiA)
  Exosomal proteins of bladder cancer cells
   HPF32_0202 (tpiA)
  Exosomal proteins of melanoma cells
   HPF32_0202 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAJ57784
UniProt: E6NN58
Structure
PDB: 

Jmol
Position
205693..206397
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIYKSHAYLEELEKTLKPQHFDRVFVFPDFLGLLPNSFLHFTLGVQN
AYPRDCGAFTGEITSQHLEELKINTLLIGHSERRMLLKESPSFLKEKFDFFKSKNFKIVY
CIGEALTTREKGLKAVKEFLNEQLENIDLNYPNLVVAYEPIWAIGTKKSASLEDIYLTHG
FLKQVLNQKTPLLYGGSVNTQNAKEILGIDSVDGLLIGSASLELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgctatggctaattttaaatccgctatgcctatttataaaagccatgcg
tatttagaagaattagaaaagactttaaaaccgcagcattttgatagggtgtttgtattc
cctgattttttggggttattgcctaattcgtttttgcatttcactttaggagtgcaaaac
gcttaccctagagattgcggggcttttaccggtgaaatcacttcacagcatttagaagaa
ctgaaaatcaacacgcttttaatagggcatagcgagaggcgaatgcttttaaaggaaagc
cctagctttttgaaagaaaagtttgatttttttaaaagtaaaaattttaaaattgtctat
tgtattggcgaagcattaacgaccagagaaaagggtttgaaggctgtaaaggaattttta
aatgagcaattagaaaatattgatcttaattatcctaatttagtggtagcgtatgagcct
atttgggcgattggcacaaaaaagagcgcttctttagaagatatttatctcacgcatggt
tttttaaagcaagttttaaatcaaaaaacgcccttgttgtatggggggagcgtgaacacg
caaaacgctaaagaaattttagggattgatagcgtggatggcttgttgattgggagcgcg
tctttggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system