KEGG   Helicobacter pylori F32: HPF32_0221Help
Entry
HPF32_0221        CDS       T01911                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
heq  Helicobacter pylori F32
Pathway
heq00300  Lysine biosynthesis
heq01100  Metabolic pathways
heq01120  Microbial metabolism in diverse environments
heq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:heq00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HPF32_0221 (dapE)
Enzymes [BR:heq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HPF32_0221 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: BAJ57803
UniProt: E6NN77
Position
complement(223957..225123)
Genome map
AA seq 388 aa AA seqDB search
MDALEITQKLISYPTITPKECGIFEYIKSLFPNFKTLECGENGVKNLFLYRIFNPPKEHI
EEKHAKKEHAKENIKPLHFCFAGHIDVVPPGNHWQSDPFKPIVKEGFLYGRGAQDMKGGV
GAFLSASLNFNPKTPFMLSVLLTSDEEGPGIFGTRLMLEKLKEKDLLPHMAVVAEPTCEK
VLGDSIKIGRRGSINGKLILKGTQGHAAYPQKCQNPIDALASVLPLISGVHLDDGDEYFD
PSKLVITNLHAGLGANNVTPASVEIIFNARHSLKTTKESLKEYLEKVLKSAPYTLELESS
SSPFITASHSKLASVLKENILKTCHATPLLNTKGGTSDARFFSAHGIEVVEFGVINDRIH
AIDERVSLKELELLEKVFLGVLENLSEK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggacgctttagaaatcacccaaaagctcatcagctaccccaccatcacgcccaaagaa
tgcggtatttttgaatacattaaatcgctttttcctaattttaaaactctagagtgtggg
gaaaatggcgtgaaaaacctttttttataccgcatttttaacccccctaaagagcatata
gaagaaaagcatgcaaaaaaagagcatgcaaaagaaaatattaagcccttgcatttttgc
tttgcagggcatattgatgtcgtgcctcctggaaatcattggcaaagcgatccctttaaa
cccattgttaaagaggggtttttatacggccgtggggcgcaagacatgaaaggaggcgtg
ggggcgtttttgagcgcgagtttaaattttaaccctaaaacccctttcatgctttctgtt
ttactcacaagcgatgaagaagggccagggatttttggcactaggcttatgttagaaaaa
ctcaaagaaaaagatttgctccctcacatggcggttgtggctgaacccacttgcgaaaaa
gtcctaggcgatagcatcaaaattggccgaagaggctccattaatggcaaacttatttta
aaaggcactcaagggcatgcagcttacccgcaaaaatgccaaaaccccattgatgcgctc
gcttctgttttgcctttgatttcaggagtccatttagacgatggcgatgaatattttgac
ccttcaaaattggttatcaccaacttgcatgcagggttaggagcgaataatgtaacgccc
gcaagcgtagaaatcatctttaatgcacgccattctttaaaaaccaccaaagaaagtttg
aaagaatatttagaaaaggttttaaaaagcgctccttacactttagaattagaatcaagc
agttcgcctttcatcacggcttcccattcaaagcttgccagcgttttaaaagaaaatatt
ttaaagacatgccatgccaccccccttttaaacaccaaaggcggcacgagcgatgcgcga
ttttttagcgctcatggcatagaagtggtagaatttggcgttattaatgacagaatccat
gccattgatgaaagggtgagcttgaaagaattagagcttttagaaaaagtgtttttgggg
gttttagagaatttaagcgagaaataa

DBGET integrated database retrieval system