KEGG   Helicobacter pylori F32: HPF32_0225Help
Entry
HPF32_0225        CDS       T01911                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
heq  Helicobacter pylori F32
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:heq00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
229576..230682
Genome map
AA seq 368 aa AA seqDB search
MVVLGSTGSIGKNALKIAKKFKVEIEALSCGKNIALINEQIKVFKPKKVAILDPNDLNAL
EPLGAKVFVGLEGIDAMVEECVSNLVINAIVGVAGLRASFKSLQTNKKLALANKESLVSA
GHLLDISQITPIDSEHFGLWALLQNKALKPKSLIISASGGAFRDTPLEFIPIQNVQNALK
HPNWSMGSKITIDSASMVNKLFEILETYWLFGASLKIDALIERNSIVHALVEFEDNSIIA
HLASADMQLPISYAINPELASLNASIKPLDLYALSAIKFEPISMERYTLWRYKDLLLENP
KLGVVLNASNEVAIEKFLNKEIAFGGLIKTISQALESYAKTPFKLSNLDEVLALDREVRE
RFGSVARM
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggttgttttaggaagcactggctctattgggaaaaacgccctaaaaatcgcaaaaaaa
ttcaaggtagaaatagaagccttaagttgtgggaaaaatatcgctttaatcaatgagcaa
atcaaagttttcaaacccaagaaagtggcgattttagatcctaacgatttgaatgcttta
gagcctttgggcgcgaaagtgtttgtagggctggagggcattgatgcgatggtagaagag
tgcgtttcaaatttagtcattaacgccattgtgggcgtggcaggattaagggcaagcttt
aaaagcttacaaactaacaaaaaactagccctagcgaataaagaaagcttggtgagcgct
gggcatttgttagacatttcacaaatcacgcccattgatagcgagcattttggtttgtgg
gcgttgttgcaaaacaaggctttaaagcctaaatccttaatcattagtgcgagtgggggg
gctttcagggacacgcctttagaatttattcctattcaaaacgtgcaaaacgcgctcaag
caccctaattggagcatgggatctaaaatcactattgattcagcgagcatggtcaataag
ctttttgaaatcctagaaacctattggctttttggcgcgtctttaaagattgatgcgctg
attgaaagaaattctatcgtgcatgctttggtggagtttgaagataactctatcatcgcg
catttagcgagcgcggacatgcaattacccataagctatgccattaaccctgaattagct
tctttgaatgcgtctatcaagccattagatttatacgctttaagcgcgattaaatttgaa
cccattagcatggagcgctacactttgtggcgttataaagacttgttgttggaaaaccca
aagcttggcgtggtgctgaatgcgagcaatgaggtggcgatagagaagtttttgaacaaa
gagatcgcttttggtgggcttatcaaaaccatttctcaagccctagaatcatacgctaaa
acgcctttcaaactctctaatttagatgaagtgctagcgttagatagggaagttagggag
cgttttggaagtgtagcgagaatgtag

DBGET integrated database retrieval system