KEGG   Helicobacter pylori F32: HPF32_0240Help
Entry
HPF32_0240        CDS       T01911                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
heq  Helicobacter pylori F32
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
246449..247246
Genome map
AA seq 265 aa AA seqDB search
MILKASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQD
LKMVVIEDPDTKYNIPLVVSKDGNLIIGLSNIFFSNKSEDVQLVAETNQKIQALNATQQN
SAKLNAIFNEIPADYAIELPSTNAANKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGMIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaaaagcgagtgtgttgagcgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacagaccaataaaaaggtgcgtattttagaaatcaaacctttaaaatccagccaggat
ttaaaaatggtcgttattgaagatccggacactaaatacaatattccgcttgtagtgagt
aaggatggtaatttaatcatagggcttagcaatatcttttttagcaataaaagcgaagat
gtgcaattagtcgcagaaaccaatcaaaaaatccaagcccttaacgctacccaacaaaat
agtgcgaaattgaacgctatttttaatgaaataccggctgattatgcgatagagttgccc
tctactaacgctgcaaataaggataaaatcctttatattgtttctgatcccatgtgcccg
cattgccaaaaagagctcactaaactcagggatcacttgaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggagtcaattcagctaaaaaagcggctttgatccaagaagaa
atggcgaaagctagggctaggggagcgagcgtggaagataaaatctctatccttgaaaag
atttattccacccaatacgatattaacgctcaaaaagagcctgaagatttacgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcatgattaagggtgtacctttctta
taccattataaggcatga

DBGET integrated database retrieval system