KEGG   Helicobacter pylori F32: HPF32_0409Help
Entry
HPF32_0409        CDS       T01911                                 

Gene name
accD
Definition
(GenBank) acetyl-CoA carboxylase subunit beta
  KO
K01963  
acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
heq  Helicobacter pylori F32
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:heq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPF32_0409 (accD)
   00640 Propanoate metabolism
    HPF32_0409 (accD)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    HPF32_0409 (accD)
Enzymes [BR:heq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     HPF32_0409 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     HPF32_0409 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
425780..426649
Genome map
AA seq 289 aa AA seqDB search
MGFADFFKNFKINKLRTAPSKEEQPSHWVKCPKCYALMYHKEVFSKYSVCLKCHYHFRMK
AAERIEFLCDVGSFEEFDKHLRPNDPLNFVDKESYKQRIKKYEKRTNRPSSVISGEAKIN
RMPLQIVVFDFSFMGGSLGSVEGEKIVRAINRAVAKREALLIVSASGGARMQESTYSLMQ
MAKTSAALNRLSEAKLPFISLLSDPTYGGVSASFAFLGDLIIAEPGAMIGFAGPRVIKQT
IGADLPEGFQTAEFLLEHGLIDMIVHRKDLKKTLSDLIAMMMHKTSKIF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgggatttgcagatttctttaaaaattttaagatcaataaattgcggacagcaccaagt
aaggaagaacagccaagccattgggtgaaatgccctaaatgttatgcgttaatgtatcat
aaagaggtgtttagtaaatacagcgtgtgtttgaaatgccattaccatttccgcatgaaa
gcggctgaaaggattgaatttctatgtgatgtggggagttttgaagagtttgacaagcac
ttacggcctaatgaccctttaaatttcgtggataaagagagctataaacaacgcattaaa
aaatacgaaaaaaggactaaccgcccaagctcagtgatcagcggtgaggctaaaatcaac
cgcatgcctttgcagatcgtggtgtttgatttcagctttatgggagggagtttaggctct
gtggagggggaaaaaatcgtaagagcgatcaatcgcgcggtcgctaaaagagaagcgtta
ttgattgtttcagcgagtgggggggctaggatgcaagaatccacttattcgctcatgcaa
atggctaaaacgagcgcggctttgaatcgattgagtgaggccaaactccctttcatttcg
ctcttaagcgatcccacttatgggggcgttagcgcgtcttttgcttttttaggggatctc
attatcgcagagcctggggcgatgataggttttgcagggcctagagtgattaagcaaact
ataggggcggatttgcctgagggctttcaaacagcggaatttttattagagcatggcttg
attgatatgattgtgcacaggaaggatttgaaaaaaactttgagcgatttgatcgctatg
atgatgcataagacttcaaagattttttaa

DBGET integrated database retrieval system