KEGG   Helicobacter pylori F32: HPF32_0421Help
Entry
HPF32_0421        CDS       T01911                                 

Gene name
homB
Definition
(GenBank) putative outer membrane protein HomB
Organism
heq  Helicobacter pylori F32
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAJ58003
UniProt: E6NNS7
Position
complement(438088..440160)
Genome map
AA seq 690 aa AA seqDB search
MRKLFIPLLLCSALEANEKNGFFIEAGFETGLLEGTQTQEKRHTTTQTTTKTTTNNYNYL
PLNSILQRATNLFKDADISKLSFSSLSPVRASLDLSGHLTIENFLPYNLNNVKLSFTDAQ
GNVIDLGVIETLPKQSKIVLSYQQFNETKQVFDNIMEEQKKYYEKEAERRKNKTTSSVSE
TKREPSFTFPTFEVLSTPHSDPNTQRVFEALSKINTNLVMKYSDTNNFESAKDKTEKFTA
KTAEEFTNLMLNMIAVLDSQSWGDAILNAPFEFTNKDGGECDTNKENECVNPGINGRVNS
QNKSYVLNKQDIVNNFRGKTDLDVSLLNGAGVDGLGSNTTPTNNDDGKNYGQLAVVASAL
NPKKLFGNNLKTINLEDLRAILHEFSHTKGYTHNGNMTYQRVPTGQNENGKPKDSDGLPY
NVCSLYGGQGQPSFPSNYPNSIYHNCADVPAGFLGVTAAVWQQLINQNALPINFANLNSQ
TNYNLNASLNTQDMANSVIGTIQKTLTTTSTTTTTSYHHSKSSQRFRSPLLGVNVKIGYQ
NYFNDFIGLAYYGIIKYNYAKAANQKVQQLSYGGGIDLLLDFITTYSNKNSPIDIQTRRN
FSSSFGIFGGLRGLYNSYYALNKVKGSGNLNVATGLNYRYKHSKYSVGISIPLIQRKASI
VSSNGDYTNSLVFNEGASHFKVFFNYGWVF
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaactattcattccacttttattatgcagcgctttagaagctaatgagaaaaat
ggctttttcatagaagccgggtttgaaactgggctgttagaaggcacacaaacgcaagaa
aaaagacacaccacgactcaaacgaccacaaaaaccaccacgaacaattacaattattta
ccactaaactccattttacaaagagcaactaatctgtttaaggatgcggatatatccaaa
ttatcgttttcctctttaagccctgttagggcgagtttagatttgagtggtcatttaact
atagaaaacttcttgccctataatttaaataatgttaagcttagctttacagacgctcaa
ggcaatgtgatcgatttaggcgtgattgaaacgctccctaagcaatctaaaatcgtttta
tcttaccaacaattcaatgaaaccaaacaggtttttgataatattatggaggagcagaag
aagtactatgaaaaagaagctgaacgcaggaaaaataaaacaactagcagtgttagtgaa
actaagcgtgagcctagcttcactttccccactttcgaagtcttgagcacgccacattct
gatcctaacacgcaaagggtgtttgaagcgctcagtaaaatcaacaccaatttggtcatg
aaatacagcgatacaaataattttgaaagcgccaaagataagacggaaaaattcaccgct
aaaaccgccgaagaattcactaatttaatgttgaacatgatcgctgtcttagactctcag
tcttggggcgatgcgattttaaacgctccttttgaattcactaataaagacggaggggaa
tgcgatactaataaagagaatgaatgcgtaaatcccgggataaacgggcgtgtcaattct
caaaataaaagttatgtgttaaacaaacaagacattgtcaataatttcagaggcaaaacg
gatcttgatgtgagtcttttgaatggagctggggttgatgggctaggttctaataccact
cccacaaataatgatgatggtaagaattacggtcaattagccgtagtcgcttcggctcta
aaccccaaaaaactctttggcaacaaccttaagactatcaatttagaggatttaagagct
atcttgcatgaattcagccacactaagggttatacccataacgggaacatgacttatcaa
agagtgccaaccggtcaaaatgaaaatggtaagccaaaagattctgatggcctcccctat
aatgtgtgttcgctttatgggggtcaaggtcagccctctttccctagcaactaccctaat
tccatctaccacaattgtgcggatgtcccggctggctttttaggggtaacagcagcggtt
tggcagcaactcatcaatcaaaacgctttacccatcaatttcgcaaatctcaatagccaa
acaaactacaacctgaacgctagtttaaacacgcaagatatggctaattctgtgattggc
accattcaaaaaaccctgacaaccacttccacgacaacaacgacttcttatcaccattca
aagagctcgcaacgcttcagatcccctttattgggcgttaatgtgaaaataggctatcaa
aattactttaatgatttcatagggttggcttattatggcatcatcaaatacaattacgct
aaagccgctaaccaaaaagtccaacaactaagctatggtggggggatagatttattgttg
gatttcatcaccacttactccaataaaaatagccctatagacattcaaaccagaaggaat
ttttcatcatcttttggtatctttggcgggttaaggggcttatataacagctattatgca
ctcaataaagtcaaaggaagcggcaatttaaatgtggctactgggttgaactaccgctat
aagcattctaaatattctgtaggcattagcatccctttaatccaaagaaaagccagcatc
gtttctagcaatggcgattatacgaactctcttgttttcaatgaaggggctagccatttt
aaggtgttttttaattacgggtgggtgttttaa

DBGET integrated database retrieval system