KEGG   Helicobacter pylori F32: HPF32_0422Help
Entry
HPF32_0422        CDS       T01911                                 

Definition
(GenBank) hypothetical protein
Organism
heq  Helicobacter pylori F32
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_4 FR47 Acetyltransf_3 zf-primase
Motif
Other DBs
NCBI-ProteinID: BAJ58004
UniProt: E6NNS8
Position
complement(440379..440864)
Genome map
AA seq 161 aa AA seqDB search
MTIKVFSPKYPTELEEFYAERVADNPLGFIQRLDLLPNISGFVQKLREHGGEFFGMRKDK
KLIGICGLNPINKTEAELCKFHINSAYQSQGLGQKLYESVERYAFVKGYTKISLHVSKSQ
IKACNLYQKLGFMPIKEEDCVVELGEEILIFPTLFMEKILS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaaagttttttcgcccaaataccctactgaattagaagaattttatgctgag
cgtgtcgctgacaaccctttagggtttatccaacgcttggatcttttgcctaacattagc
gggtttgttcaaaaattgcgcgagcatggcggggaattttttggaatgagaaaggataaa
aagctcatcgggatctgcgggcttaatcctatcaacaaaacagaagcagagctgtgcaaa
ttccacataaatagcgcttatcaatcccaagggttgggtcaaaaactctatgagagcgtg
gaacgatacgcttttgttaaaggctatactaaaatctctctgcatgtgagcaaaagccaa
atcaaggcatgcaatctttatcaaaaactgggttttatgccaatcaaagaagaagattgc
gtggtggagttgggagaagagattttgattttccctactctttttatggaaaagattctg
tcttaa

DBGET integrated database retrieval system