KEGG   Helicobacter pylori F32: HPF32_0424Help
Entry
HPF32_0424        CDS       T01911                                 

Definition
(GenBank) hypothetical protein
  KO
K01737  
6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50]
Organism
heq  Helicobacter pylori F32
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:heq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPF32_0424
Enzymes [BR:heq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.50  6-carboxytetrahydropterin synthase
     HPF32_0424
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     HPF32_0424
Transfer RNA biogenesis [BR:heq03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    HPF32_0424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(441627..442229)
Genome map
AA seq 200 aa AA seqDB search
MVIRRLFKFCASHVVRNCSSLKCAQNIHGHNYEVEVFIETNRLDNANMALDFGLMQQEMQ
VFIESFDHAHHFWDKESDEFQRFIENHCVRYVKCSFNLSAESYALMFLYYLTRILQKSVF
SNNEGELKISSVRVHETKNGYAESFLKDLENPHFKSLVHNHCISFSQGIQKLWHDKDFFN
KIISDEKQCFFHAKPLHQIP
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggttatcaggcgattgtttaaattttgcgctagccatgtggtgcgcaattgctcctct
ttaaaatgcgctcaaaatatccatgggcataattatgaagtggaggtttttattgaaacc
aaccgcttagataatgcgaacatggcgttagattttgggctgatgcaacaagaaatgcaa
gttttcattgagtcgtttgatcatgcccatcatttttgggacaaagaaagcgatgagttt
cagcgttttatagaaaatcattgcgttcgttatgtgaaatgctcgttcaatttgagtgca
gaaagttacgctctcatgtttttatactacctgacaaggattttacaaaagagcgttttt
tccaataatgaaggggagttaaaaatctctagcgtgcgcgtgcatgagactaaaaacggc
tatgcggagagctttttaaaagatttagaaaacccacattttaaatctttagtgcataat
cattgcatctctttctcgcaaggcattcaaaaattgtggcatgataaggattttttcaat
aaaatcattagcgatgaaaaacaatgctttttccacgctaaacccctacaccagatccca
tga

DBGET integrated database retrieval system