KEGG   Helicobacter pylori F32: HPF32_0428Help
Entry
HPF32_0428        CDS       T01911                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
heq  Helicobacter pylori F32
Pathway
heq00790  Folate biosynthesis
heq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:heq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPF32_0428 (folE)
Enzymes [BR:heq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     HPF32_0428 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF DUF3638
Motif
Other DBs
NCBI-ProteinID: BAJ58010
UniProt: E6NNT4
Position
complement(444616..445158)
Genome map
AA seq 180 aa AA seqDB search
MENFFNQFFENIGEDKNREGLKETPKRVQELWKFLYKGYKEDPKVALKSAYFQGVCDEMI
VAQNIEFYSTCEHHLLPFLGSISLGYIPKEKIVGISAIAKLIEIYSRRLQIQERLTTQIA
ETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLKGLFKKDPKTRAEFIQLLKS
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattttttcaaccagttttttgaaaatatcggcgaagataaaaacagagaaggc
ttgaaagagacgcctaaaagggttcaagaattatggaaattcttgtataaaggctataaa
gaagatcctaaagtggctttaaaaagcgcgtattttcaaggcgtttgcgatgaaatgata
gtggctcaaaacattgaattttactccacttgcgaacaccacttgctcccttttttgggg
agtatcagtttaggatacattcctaaagaaaagattgtaggcattagcgcgatcgctaaa
ctcattgaaatttatagcagacgcttgcaaatccaagaaaggctgaccactcaaattgcc
gaaacctttgatgaaatcatagagccaaggggcgtgattgtagtttgtgaagccaagcat
ttgtgcatgagcatgcaaggggtgcaaaagcaaaatgcgatcattaaaacaagcgttcta
aaaggcctctttaaaaaagaccctaaaaccagagctgaatttatacaactcttaaaatct
tag

DBGET integrated database retrieval system