KEGG   Helicobacter pylori F32: HPF32_0434Help
Entry
HPF32_0434        CDS       T01911                                 

Definition
(GenBank) putative vacuolating cytotoxin (VacA) paralog
Organism
heq  Helicobacter pylori F32
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VacA2
Motif
Other DBs
NCBI-ProteinID: BAJ58016
UniProt: E6NNU0
Position
complement(449365..456552)
Genome map
AA seq 2395 aa AA seqDB search
MAFKKAGLISKFISKGSFKLNKISKKIFKLNLILKHEKPLSHKKTKSVKKPFNQNKSFLK
ASVLLIGALGGLSHLRASECRYWSWSSWSYHDNIESGSNSPTHNSYCLFNSAQGSGTYYL
NTLTTYSAGGASFTQKFNNGTLDVGGNIRFGGTGVNGGDVGYITGTYDSQTINFNSSRIT
TGNSFSTGGGTTLNFNATNHITINQASFDNGDAGTQHSYMNFSGSNINVSDSSFTDDTNG
GFSFSGNGTNSNLSFDKTNFNQGTYKFTNSANLNFNNSAFNQGSYHFNSAQSVFENSNFN
QGTYNFNDNTSFNNDTFNQGTYSFNTNKVSFSGINTLNSSSPFANLKGSVSFGSDAIFNL
NQTLNTNQTYDILTTNGTIQYGVYQSYLWDLINYKGDKAISHVEVGSNTYDVTFDINGQD
ETLQETFNKQAITTQFLGDDLQAKAQATYQQDLSNSQTALNNATSDNKIASSDTGYTNNQ
NTTIKKDAQSLENTSQQIVKDQRALQQDLDNLKQLANSPTGFNQQAFKNTQSTEQQDLQT
LQENENTFNSEQEGLKQAIANANPASPTPSPTPTPTKHTAPNTPPNKVPPTPPTQNLPTT
NVWNGVYNLQNQTYSKQGVYYIDPNLSGQSGQSGNTLSTYTANLLGRSFGMNIQNGTLII
GNNTESVNDNGLIWIGHGGFGYIIGTFNAANIYLTNNFKTGEGVSNSDGGGANITFKASD
NITMDGLDYNDAETVTKMIQTGASQHSYAAFDATNNISVTNSSFSDMTWGEFSFSAKNIS
FSNASFSGFTNPGGSSVISANAANSLSFNNSRLNGGAVYNLWANSLIFNNTQAVFNVLYS
RGTSNFNATTQLLGNTNFTLSSQSLLNFNGDTTLQNNANITLGNKSQAAFKNSLTLDNNS
NLSLDNQSVLNANGASAFNNQASLNIYNGSQATFKSLFFNGGTLSLNASSKLNASNASFS
NNTTINLDDSVLSASNTSSLNANINFQGASQANFGGNTTIDTASFNFDSASSLSFNNLTA
NGALNFNGYAPSLSKALMSVSGQFVLGNNGDINLSDINIFDNITKSVTYSILNAQKGITG
ISGANGYEKILFYGMKIQNATYSDNNNIQTWSFINPLNSSQIIQESIKNGDLTIEVLNNP
NSASNTIFNIAPELYNYQASKQNPTGYSYDYSDNQAGTYYLTSNIKGLFTPKGSQTPQTP
GTYSPFNQPLNSLNIYNKGFSSGNLKTLLGILSQNSATLKEMIESNQLDNITSINEVLQL
LDKIKITPAQKQALLETINHLTDNINQTFSNGNLVIGATQDNVTNSTSSIWFGGNGYSSP
CALDSATCSSFRNTYLGQLLGSTSPYLGYINADFKAKSIYITGTLGSGNAFESGGSADVT
FQSANNLVLNKANIEAQATDNIFNLLGQEGIDKIFNQGNLANVLSQVAMEKIKQAGGLGN
FVENALSPLSKELPASLQNETLGQLIGQNNLDDLLNNSGVMNAIQNIISKKLSIFGNFVT
PSIIENYLAKQSLKSMLDDKGLLNFIGGYMDASELSSILSVILKDITNPPTSLQKDIGVV
ANDLLNEFLGQDVVKKLESQGLVSNIINNIISQGGLSGIYNQGLGSVLPLSLQNALKEND
LGALLSPRGLHDFWQKGYFNFLSNGYVFVNNSSFSNATGGSLNFVANKSIIFNGDNTIDF
SKYQGALIFASNGVSNINITTLNATNGLSLNAGLNNVSVQKGEICINLANCPTTKNSSST
NSSVTPTNESLSVRANNFTFLGVIASNGAIDLSQVKNNSVIGTLNLNENATLQANNLTIT
NAFNNASNSTANINGNFTLNQQATLSTNASGLNVMGNFNSYGDLVFNLSHSASHAIINAQ
GTATIMANNNSPLIQFNTSSKETGAYTLIDSAKAIYYGYNDQITGGNSLADYLKLYTLID
INGKRMVMSNNGLTYNGQAVNIKDGGLIVGFKDSQNQYIYTSILYNKVKIAVSNDPISNL
QAPTLKQYIAQIQGAQGVDSIEQVGGTQAINWLNKIFETKGSPLFAPYYLESHSTKDLTT
IAGDIANTLEVIANPDFKNDATNILQINTYTQQMSRLAKLSDTSTFASADFHERLEALKN
KRFADAIPNAMDVILKYSQRNRVKNNVWATGVGGASFINGGTGTLYGINIGYDRFIKGVI
VGGYAAYGYSGFHANITQSGSSNVNMGVYSRAFIKRSELTMSLNETWGYNKTFINSYDPL
LSIINQSYKYDTWTTDAKINYGYDFMFKDKSVIFKPQIGLAYYYIGLSGLRGIMDDPIYN
QFRANADPNKKSVLTINFALESRHYFNKNSYYFVIADVGRDLFINSMGDKMVRFIGNNTL
SYRDGGRYNTFASIITGGEIRLFKTFYVNAGIGARFGLDYKDINITGNIGMRYAF
NT seq 7188 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttaaaaaggctggattgatttctaagtttatttcaaagggatcttttaaatta
aataagatctcaaagaaaattttcaaattgaatctaatcttgaagcatgaaaagccctta
agccataaaaaaacaaaatccgttaaaaagccctttaatcaaaacaaatcttttttaaaa
gcttcggttttattgataggagcgttggggggattatcccacctaagggctagcgagtgc
cgttattggtcatggtcgtcttggagttatcatgacaatattgaaagcggttctaattcc
cccacgcacaactcttattgtctttttaatagcgctcaaggctctgggacttactatttg
aacacccttaccacttatagcgctggtggggctagtttcacgcaaaaattcaataatggc
acgcttgatgtgggagggaatatccgctttggaggcacgggtgttaatggaggtgatgta
gggtatatcacaggcacttatgactctcaaacgattaattttaattctagccgtatcaca
accggcaactcattttctactggcggtgggaccactctcaattttaatgcaactaaccat
atcactatcaatcaagccagctttgataacggcgatgcaggaacacagcactcctacatg
aatttcagcggttctaacatcaatgtgagcgactctagctttacagacgacaccaatggg
ggctttagtttcagcgggaatgggactaacagcaatctctcttttgacaaaacgaacttc
aatcaaggcacttataaattcactaacagcgctaacttaaacttcaacaacagcgctttc
aatcaagggagttatcactttaatagtgctcaatctgtttttgaaaacagcaatttcaat
caaggtacttataattttaatgacaatactagctttaataacgacaccttcaatcaaggc
acttatagctttaatacgaataaggtgagtttctcaggcattaacactttaaattcaagt
tcgccttttgctaaccttaaaggcagtgtgtcttttggttctgatgcgatttttaacctc
aatcaaacccttaataccaatcaaacctatgacattctcaccacaaacgggactatccaa
tatggggtttatcaaagctatttgtgggatttgatcaactataagggcgataaagctatt
agccatgttgaagtgggtagtaacacttatgatgtaacctttgacattaacgggcaagat
gaaaccttacaagaaacctttaacaaacaagccattaccacccaatttttaggggacgat
ttacaagccaaagcccaagcaacctaccaacaagacttgagtaactcccaaaccgcttta
aataacgctactagcgataataagatcgcaagcagtgatacaggctacaccaacaatcaa
aacaccactatcaaaaaagacgctcaaagtttagaaaacactagccaacaaatcgttaaa
gatcaacgagcgttacaacaagatttagacaatctcaaacaattagctaactccccaaca
ggctttaaccaacaagctttcaagaatacccaaagcacagaacaacaagatttacaaacc
ttacaagagaatgaaaatacttttaatagcgagcaagaggggttaaaacaagcgatagct
aacgctaatcctgcaagcccaacaccaagccctacacccactcccacaaagcacacagcg
ccaaacactccccctaataaagttccacccacaccccctactcaaaatttacccacaacg
aatgtgtggaatggagtctataaccttcaaaatcaaacttactcaaaacaaggcgtttat
tatattgatcccaatctttcaggacagagcggtcaaagcggcaacacgctcagcacttat
acagccaatttattaggaagaagttttggcatgaatatccaaaatggcactttgatcata
gggaataacacagagagcgtgaatgataatgggttgatttggatagggcatggaggcttt
ggctatatcattgggacttttaatgcggctaatatttacttgaccaataattttaaaacc
ggtgaaggcgtttcaaattcagatggtggaggagcgaacattacctttaaagcaagcgat
aatatcactatggatggcttggattataatgacgctgaaaccgttactaaaatgattcaa
acgggggctagtcagcattcctatgccgcttttgacgctacaaacaatatcagcgtgact
aattccagttttagcgatatgacttggggggaattcagttttagcgctaagaatatttcg
ttttctaacgcttcgtttagtggctttacaaaccctggaggatcaagcgttatcagcgct
aatgccgctaattctttaagctttaacaattctcgtttgaatgggggagcggtttataat
ttgtgggctaatagccttattttcaacaacacgcaagcggtttttaatgtcttgtattct
agggggacaagcaattttaacgctaccacacagcttttaggcaacacgaattttacgctc
agctctcaaagtttgctgaactttaatggcgatacaaccttgcaaaacaacgccaatatc
acgcttggcaataaaagtcaagccgcttttaaaaattctttaacgcttgataataattct
aatttaagtttagacaatcaaagcgttttgaatgcgaacggtgcgagcgcttttaacaat
caagcgagtctcaatatttataacgggagtcaagcaacctttaaaagcctcttttttaat
ggcgggacactcagtcttaacgctagtagcaagctcaacgcttctaacgctagtttttca
aacaacaccactattaatttagacgatagcgttttatcggctagtaacacaagctcttta
aacgctaatatcaattttcaaggcgcaagccaggctaattttggaggcaacacgactatt
gatacagcaagctttaattttgacagcgcaagctcattgagttttaacaaccttacggct
aatggggcgttaaattttaatggttatgcgccctctttatctaaggctttaatgagcgtt
agcgggcagtttgttttagggaataatggggatattaatttatctgacatcaatattttt
gacaacattacaaaatctgtaacctacagcatcctaaacgctcaaaaaggcattactggc
attagtggggctaatggctatgaaaaaatccttttttatggcatgaaaatccaaaacgct
acctatagcgataacaataacattcaaacttggtcgtttataaaccctctcaattcttct
caaatcattcaagagagcattaaaaatggggatttaaccatagaagttttaaataaccct
aactcagcttctaacactatttttaatatcgctcctgagctttataattaccaagcttct
aagcaaaatcctaccggttatagctatgattatagcgataaccaagcaggcacttattac
ttgacaagcaacattaaaggtcttttcacccctaaaggctctcaaacgcctcaaacccca
ggcacttatagcccgtttaaccagcctttgaatagtttgaatatctacaataagggtttt
tctagtggaaatttaaaaacgcttttagggatcctttctcaaaattccgccaccttaaaa
gaaatgattgaatccaatcaattagacaatatcactagcatcaatgaagtgttgcaactc
ttagataagattaagatcaccccagcgcaaaagcaagcgctcctagaaaccatcaaccat
ttgactgacaacatcaatcaaacctttagtaatgggaatctcgtgataggcgctactcaa
gataatgttacaaactctactagctctatatggtttgggggtaatggttatagcagtcct
tgcgcgctagatagcgccacttgttcttcttttagaaacacttacttggggcaattatta
ggctcaacttccccctatttaggctacatcaacgctgattttaaagctaaaagcatttat
atcactggaacgcttggaagcggtaacgcctttgaaagcggagggagcgcggatgtaacc
tttcaaagcgctaataacttagtgctgaataaagctaacatagaagctcaagccacagac
aatatctttaatcttttgggtcaagaagggattgataaaatctttaatcaagggaattta
gcgaatgttctcagtcaagtggctatggaaaaaatcaagcaagccggcggtttagggaac
tttgtagaaaacgctctaagccctttgagtaaggaattacccgctagcttgcaaaatgaa
accttaggccaacttataggtcaaaataatttagatgatttattgaataatagtggagtc
atgaatgcaatccaaaatattatcagtaaaaaactaagcatttttggtaattttgttacc
ccatccatcatagaaaactaccttgctaagcagtctttaaaaagcatgctagacgataaa
gggcttttgaattttatcggtgggtatatggacgcttctgaattaagctctattttaagc
gtgattttaaaagacattactaatccccctacaagcttgcaaaaagacattggtgtggtg
gcgaacgacttgttgaacgagtttttaggacaagatgttgttaaaaagctagaaagtcaa
ggtttagtgagtaatatcattaataatattatttctcaaggcgggttaagcggcatttat
aatcaaggtttggggagcgtgttgccgctctctttacaaaacgcgctcaaagaaaacgat
ttaggcgctcttttatcgcctagaggcttgcatgatttttggcaaaaagggtattttaac
tttttaagcaatggctatgtttttgtcaataatagctcttttagcaacgctacagggggc
agtttgaattttgtcgccaacaagtctattatttttaatggcgataacacgattgatttt
agcaagtatcaaggcgcattgatttttgcttctaatggtgtttctaatatcaatatcaca
accctaaacgctactaacggcttaagccttaatgcgggtttgaataatgtgagcgttcaa
aaaggggaaatttgcatcaatttagccaattgccccacaacaaaaaacagctcttctaca
aattctagcgtaacccccactaacgaatctttaagcgtgcgcgctaacaacttcactttc
ttaggcgtaatcgcttctaatggggctattgatttgtctcaagtaaaaaataatagcgtt
ataggcacgctcaatcttaatgaaaatgcgaccttacaagccaataatttaacgatcact
aacgcttttaacaacgcctctaactctacagctaacattaatggtaatttcaccttaaac
caacaagcgactttaagcactaacgctagtggtttgaatgtcatggggaattttaatagc
tatggcgatttggtgtttaatctcagccattcagctagccatgccattatcaacgctcaa
ggcacagcgacgattatggctaataacaatagtcccttaatccaattcaacacttcttca
aaagaaacaggcgcttacacgctcattgatagcgctaaagccatttattatgggtataac
gaccaaatcacaggaggcaatagcctagccgattaccttaagctttacacgctcattgac
attaatggcaagcgcatggtgatgagtaacaacggcttaacttataacgggcaagccgtg
aatattaaagatggcggtttaattgtaggctttaaagactctcaaaatcaatacatttac
acttccattctttataataaagtgaaaatcgctgtttctaatgatcctatcagcaactta
caagcccccactttaaaacaatatatcgctcaaattcagggcgctcaaggcgtggatagc
attgagcaagttggaggcactcaagcgattaattggctcaataaaatctttgaaactaag
ggaagtcctttattcgctccctattatttagaaagccattccacaaaagatttaaccacg
atcgctggagacattgctaacactttagaagtcatcgctaaccctgattttaaaaatgat
gccaccaatattttacagatcaacacctacacgcaacaaatgagccgtttagccaaactc
tctgacacttcaacctttgctagcgctgatttccatgagcgtttagaagcccttaaaaac
aagcgattcgctgatgcgatccctaacgctatggatgtgattttaaaatactctcaaaga
aacagagttaaaaataatgtgtgggcgacaggagttggaggggctagttttattaatgga
ggcactgggactttatatggtatcaatatagggtatgacaggtttattaagggcgtgatt
gtggggggttatgccgcttatgggtatagcgggtttcatgcaaacatcactcaatcaggc
tctagcaatgttaatatgggtgtttatagccgagcctttatcaaaagaagcgaattaacg
atgagcttgaatgagacttggggatacaataagactttcatcaactcttatgacccccta
ctctcaatcatcaaccagtcttacaaatacgacacctggacgactgacgctaaaatcaat
tacggctatgatttcatgtttaaagataaaagcgttatttttaaacctcaaataggctta
gcctattattacattggtttgtctggtttaaggggcattatggatgatcctatttacaac
caattcagagccaatgctgaccctaataaaaaatccgttctaacgattaattttgcccta
gaaagtcggcattatttcaataaaaactcttattattttgtgattgcggatgtgggcaga
gatttgtttatcaattctatgggggataaaatggtgcgtttcatcggtaataacacccta
agctatagagatggcggcagatacaacacttttgctagcattatcacaggcggggagata
agattattcaaaaccttttatgtgaatgccggcataggggctaggtttgggcttgattat
aaagatattaatattaccggaaatattggtatgcgctatgctttttaa

DBGET integrated database retrieval system