KEGG   Helicobacter pylori F32: HPF32_0468Help
Entry
HPF32_0468        CDS       T01911                                 

Definition
(GenBank) hypothetical protein
Organism
heq  Helicobacter pylori F32
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sec20
Motif
Other DBs
NCBI-ProteinID: BAJ58050
UniProt: E6NNX4
Position
502157..503512
Genome map
AA seq 451 aa AA seqDB search
MNEREIYDLNYAIVKAKDLKPSFTTGGTQKRTDMNEEQIKSIAENFDPKKIFGSGGFEDL
PIILNDGQVIAGNHRVQGMLNFTPKSRYIYEKAIKEYYHIDLKPDELLVRVPSKRLNNTE
INNLAASSNQGRFNSESDHAIAVLSHYEPKLKELETKLNADSIYSLKNMVAKNLNFDKAT
HPNVGDSNLALLMFNMPRTKTQGIELLNRWQKEFTNDIKSYEKVKKMFVDNAGSFHNLIH
DMSFPNVNLNAYLSDIMDRSFANLKNYQTTSESLKDLSEKFYKTSSLEMFEKSDQSTSDI
SEILGGAIARFARFDDLSKALFEALRSDNIKKGLKEFKIADVTKDMFNPDSKEFKDIDIY
DFTHYLLMANREPNENNPTLKRLIQAVKDMQKENEKAIKEVSKKSAEEAEKGIKKDYSDT
NLNANQVKELLNNAKIPTSGRDAILFLERIT
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgaacgagagatttacgatctaaattatgcgatcgtgaaagctaaagatttaaaa
ccaagctttaccacaggcggaacgcaaaaacgcaccgacatgaacgaagaacagattaaa
agcattgctgaaaattttgatcctaaaaagatatttgggagtggaggttttgaagatttg
ccgattatcttaaacgacggccaagtgatcgcaggaaaccaccgagtccaaggcatgcta
aatttcacgcctaaaagccgttacatttacgagaaagcgatcaaggaatactatcacata
gatttaaaaccagacgagctattagttagagtgccttctaaacgcctaaacaacaccgag
atcaacaatttagcagcctcaagcaatcaaggccgtttcaatagtgaaagcgatcacgcc
atagcggttttaagccactacgagccgaaattaaaagaattagaaacgaagctaaacgct
gatagcatttattcattaaaaaacatggttgctaaaaatttgaattttgacaaggctact
caccctaatgtaggcgatagcaacttagcccttttaatgtttaacatgccaaggactaaa
acgcaagggatagaattactcaaccgctggcagaaagaatttactaacgacattaaaagc
tatgaaaaagtaaaaaaaatgtttgtagataatgcgggcagttttcacaatctcatccac
gatatgagcttccctaatgtaaacttaaacgcttatttaagcgatattatggatcgcagt
tttgcgaatttaaagaattatcaaaccacaagcgaaagcttgaaagatttgagcgaaaaa
ttctataaaacgagttctttagagatgtttgaaaagagcgatcaaagcacaagcgatata
agcgagattttaggaggtgcgatcgcacgatttgcgaggtttgatgatctaagtaaggca
ttatttgaagccttaagaagcgataacattaaaaaaggtttgaaagaatttaagatcgca
gatgttactaaagacatgtttaaccctgatagtaaagagtttaaggacattgatatttac
gatttcacgcattaccttttaatggctaatagagagccaaatgaaaataaccctacctta
aagcgcttgatacaagccgtgaaggacatgcaaaaagaaaacgagaaagcgataaaagaa
gttagcaaaaagagtgcagaagaagcagagaaagggattaaaaaagattatagcgacacg
aatttaaacgctaatcaagttaaagagctattaaataacgcaaaaatccctacaagcggg
agagacgctattttatttttggaaagaataacctaa

DBGET integrated database retrieval system