KEGG   Helicobacter pylori F32: HPF32_0481Help
Entry
HPF32_0481        CDS       T01911                                 

Gene name
pldA
Definition
(GenBank) phospholipase A1
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
heq  Helicobacter pylori F32
Pathway
heq00564  Glycerophospholipid metabolism
heq00565  Ether lipid metabolism
heq00592  alpha-Linolenic acid metabolism
heq01100  Metabolic pathways
heq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:heq00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HPF32_0481 (pldA)
   00565 Ether lipid metabolism
    HPF32_0481 (pldA)
   00590 Arachidonic acid metabolism
    HPF32_0481 (pldA)
   00591 Linoleic acid metabolism
    HPF32_0481 (pldA)
   00592 alpha-Linolenic acid metabolism
    HPF32_0481 (pldA)
Enzymes [BR:heq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     HPF32_0481 (pldA)
    3.1.1.32  phospholipase A1
     HPF32_0481 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: BAJ58063
UniProt: E6NNY7
Position
513578..513946
Genome map
AA seq 122 aa AA seqDB search
MSAGQRPVFRLVWEKGGLKIMVAYWPYVPYDQSNPNLIDYMGYGNAKVDYRRGRHHFELQ
LYDIFTQYWRYDRWHGAFRLGYTYRINPFVGIYAQWFNGYGDGLYEYDVFSNRIGVGIRL
NP
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcggggcaacgccctgtgtttcgtttggtgtgggaaaagggaggcttgaagatc
atggtcgcttattggccctatgtcccttatgatcaatccaaccctaatttgattgattac
atggggtatggtaacgctaaagttgattacaggagagggcgccatcattttgaattgcaa
ctttatgatattttcacgcaatactggcgttatgatcgctggcatggagctttccgctta
ggctatacctaccgcattaacccttttgtggggatttatgcgcagtggtttaacggctat
ggcgatggcttgtatgaatacgatgttttttccaatcgtataggggtaggaatacgctta
aacccttaa

DBGET integrated database retrieval system